BLASTX nr result
ID: Gardenia21_contig00009778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00009778 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05857.1| unnamed protein product [Coffea canephora] 86 1e-14 >emb|CDP05857.1| unnamed protein product [Coffea canephora] Length = 342 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -3 Query: 148 MTCQRPHYIVASKYPQRSILSYGNYKKHSEMSMKSTSEVGTTNKLKLAT 2 MTCQR HYIVASKYPQRSILS+GNYKKHSEM MK TSEVG +KLKL T Sbjct: 1 MTCQRLHYIVASKYPQRSILSHGNYKKHSEMPMKCTSEVGAADKLKLTT 49