BLASTX nr result
ID: Gardenia21_contig00008424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00008424 (544 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05002.1| unnamed protein product [Coffea canephora] 99 9e-19 >emb|CDP05002.1| unnamed protein product [Coffea canephora] Length = 869 Score = 99.4 bits (246), Expect = 9e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -2 Query: 540 SESRHGQSTLLTYGNGTNSEKNDFGSSQNKGPTQWKTSGGIVGNQQGRI 394 SESRHGQSTLLTYGNGTNSEKNDFGSSQNKG TQWKTSG +VGNQQGR+ Sbjct: 812 SESRHGQSTLLTYGNGTNSEKNDFGSSQNKGSTQWKTSGSVVGNQQGRV 860