BLASTX nr result
ID: Gardenia21_contig00005910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005910 (274 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15027.1| unnamed protein product [Coffea canephora] 71 7e-15 >emb|CDP15027.1| unnamed protein product [Coffea canephora] Length = 432 Score = 70.9 bits (172), Expect(2) = 7e-15 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -3 Query: 137 ALYIEAQVHSSLSEATQNFVIKEFNHYLPIEPYENIEDN 21 AL+IEAQVHSSLSEATQNFVI+EFNHYLPI+PYE IE++ Sbjct: 91 ALFIEAQVHSSLSEATQNFVIEEFNHYLPIKPYEIIENS 129 Score = 36.2 bits (82), Expect(2) = 7e-15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 181 GRIQDDIFVDCNDSG 137 GRIQDD+FVDCNDSG Sbjct: 76 GRIQDDVFVDCNDSG 90