BLASTX nr result
ID: Gardenia21_contig00005861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005861 (683 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04646.1| unnamed protein product [Coffea canephora] 73 1e-10 >emb|CDP04646.1| unnamed protein product [Coffea canephora] Length = 498 Score = 72.8 bits (177), Expect(2) = 1e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 487 LAIPDFVLDSSVGVAPSGCTEAFANSKSLLPPPYTTTAKK 368 +AIPDFVLDS VGVAPSGCTEAFANSKSLLPPP+ TT K+ Sbjct: 455 VAIPDFVLDSPVGVAPSGCTEAFANSKSLLPPPHITTEKE 494 Score = 20.8 bits (42), Expect(2) = 1e-10 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 513 TIKSLLEETWQFLTSF 466 TIKSLLEET + F Sbjct: 445 TIKSLLEETLVAIPDF 460