BLASTX nr result
ID: Gardenia21_contig00005803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005803 (985 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05877.1| unnamed protein product [Coffea canephora] 64 1e-07 >emb|CDP05877.1| unnamed protein product [Coffea canephora] Length = 281 Score = 64.3 bits (155), Expect = 1e-07 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = -2 Query: 315 MKITIILSSSYLWLFVLLNSANPYANITSQRRQ*KNRRA*ICQKITLPDGFLFGVATSSY 136 MKIT ILSSS WLFVLLNSANP A + + K ++ P GFLFGVATSSY Sbjct: 1 MKITTILSSSCFWLFVLLNSANPCATVFYKGGNEKTEELEDVKRSHFPGGFLFGVATSSY 60 Query: 135 QV 130 Q+ Sbjct: 61 QI 62