BLASTX nr result
ID: Gardenia21_contig00005697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005697 (415 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03541.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger d... 60 6e-07 ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger d... 58 3e-06 ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger d... 57 7e-06 >emb|CDP03541.1| unnamed protein product [Coffea canephora] Length = 293 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 413 EMIDQSQYRCPICSKSVFNMSRTWERLEQEV 321 EMI QSQYRCPICSKSVFNMSRTWERL+ E+ Sbjct: 210 EMISQSQYRCPICSKSVFNMSRTWERLDLEI 240 >ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Sesamum indicum] Length = 282 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 413 EMIDQSQYRCPICSKSVFNMSRTWERLEQEV 321 EM Q+QYRCPICSKSV NMSRTWERL+QE+ Sbjct: 198 EMFSQNQYRCPICSKSVLNMSRTWERLDQEI 228 >ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Nicotiana sylvestris] Length = 287 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 413 EMIDQSQYRCPICSKSVFNMSRTWERLEQEV 321 +MI Q+QYRCPICSKSV NMSRTWERL+ E+ Sbjct: 204 DMIQQNQYRCPICSKSVLNMSRTWERLDLEI 234 >ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Erythranthe guttatus] gi|604348557|gb|EYU46712.1| hypothetical protein MIMGU_mgv1a011426mg [Erythranthe guttata] Length = 282 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 413 EMIDQSQYRCPICSKSVFNMSRTWERLEQEV 321 EM +Q+QYRCPICSKSV NM+RTWERL+ E+ Sbjct: 198 EMFNQNQYRCPICSKSVLNMARTWERLDVEI 228