BLASTX nr result
ID: Gardenia21_contig00004997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00004997 (1022 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19029.1| unnamed protein product [Coffea canephora] 136 3e-29 ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prun... 94 1e-16 ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-16 ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily p... 94 2e-16 ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein... 94 2e-16 ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein... 94 2e-16 ref|XP_008219858.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-15 ref|XP_008343880.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-14 gb|KHG09041.1| hypothetical protein F383_36318 [Gossypium arboreum] 84 2e-13 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-13 ref|XP_012451197.1| PREDICTED: pentatricopeptide repeat-containi... 82 9e-13 ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Popu... 81 2e-12 ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-12 ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-12 ref|XP_011081891.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-12 ref|XP_012474396.1| PREDICTED: pentatricopeptide repeat-containi... 79 8e-12 ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-11 gb|KHG18640.1| hypothetical protein F383_26294 [Gossypium arboreum] 78 1e-11 gb|KHN10387.1| Pentatricopeptide repeat-containing protein, mito... 76 5e-11 ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containi... 76 5e-11 >emb|CDP19029.1| unnamed protein product [Coffea canephora] Length = 593 Score = 136 bits (342), Expect = 3e-29 Identities = 68/73 (93%), Positives = 69/73 (94%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MAQKI DLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKT S PRK VKH Sbjct: 521 KMAQKISDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTYSNPRKLVKH 580 Query: 842 RYLPKSGVSRADR 804 RYLPKSGVSRADR Sbjct: 581 RYLPKSGVSRADR 593 >ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] gi|462418970|gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 94.4 bits (233), Expect = 1e-16 Identities = 44/73 (60%), Positives = 59/73 (80%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA K+C++MSSVPHS LPNTY + SHAR+K+I++KA MSD+LKTCS PR+ VK+ Sbjct: 525 EMAHKMCNMMSSVPHSTNLPNTYVRERDASHARRKSIIQKAEAMSDLLKTCSDPRELVKY 584 Query: 842 RYLPKSGVSRADR 804 R LP++ VSRA++ Sbjct: 585 RSLPENVVSRANQ 597 >ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Fragaria vesca subsp. vesca] Length = 591 Score = 94.0 bits (232), Expect = 2e-16 Identities = 47/73 (64%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA+K+C LMSSVPHS KLPNTY + SH R+K+I+KKA MS VLKTCS PR+ VKH Sbjct: 507 EMARKLCALMSSVPHSTKLPNTYVKDRDESHERRKSIIKKAEAMSKVLKTCSDPRELVKH 566 Query: 842 RYLPKSGVSRADR 804 R P+S SRA+R Sbjct: 567 RSSPESVESRANR 579 >ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|590579336|ref|XP_007013758.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784119|gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 94.0 bits (232), Expect = 2e-16 Identities = 45/73 (61%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+CD+MSSV SKKLPNTYG E+ S AR+ +IM+KA MSD+LKTC PR+FVKH Sbjct: 472 DMASKLCDMMSSVRSSKKLPNTYGGDEDSSRARRTSIMRKAEAMSDMLKTCKDPREFVKH 531 Query: 842 RYLPKSGVSRADR 804 R L ++ VS A R Sbjct: 532 RTLSENAVSSAGR 544 >ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] gi|508784117|gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 94.0 bits (232), Expect = 2e-16 Identities = 45/73 (61%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+CD+MSSV SKKLPNTYG E+ S AR+ +IM+KA MSD+LKTC PR+FVKH Sbjct: 496 DMASKLCDMMSSVRSSKKLPNTYGGDEDSSRARRTSIMRKAEAMSDMLKTCKDPREFVKH 555 Query: 842 RYLPKSGVSRADR 804 R L ++ VS A R Sbjct: 556 RTLSENAVSSAGR 568 >ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579326|ref|XP_007013755.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579333|ref|XP_007013757.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784116|gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 94.0 bits (232), Expect = 2e-16 Identities = 45/73 (61%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+CD+MSSV SKKLPNTYG E+ S AR+ +IM+KA MSD+LKTC PR+FVKH Sbjct: 507 DMASKLCDMMSSVRSSKKLPNTYGGDEDSSRARRTSIMRKAEAMSDMLKTCKDPREFVKH 566 Query: 842 RYLPKSGVSRADR 804 R L ++ VS A R Sbjct: 567 RTLSENAVSSAGR 579 >ref|XP_008219858.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Prunus mume] gi|645226050|ref|XP_008219860.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Prunus mume] Length = 607 Score = 91.3 bits (225), Expect = 1e-15 Identities = 43/73 (58%), Positives = 57/73 (78%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA K+C++MSSVPHS LPNTY + SHAR+K+I+ KA MSD+LKTCS PR+ VK+ Sbjct: 523 EMAHKLCNMMSSVPHSTNLPNTYVRERDASHARRKSIILKAEAMSDLLKTCSDPRELVKY 582 Query: 842 RYLPKSGVSRADR 804 R P++ VSRA++ Sbjct: 583 RSSPENVVSRANQ 595 >ref|XP_008343880.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] gi|658017046|ref|XP_008343881.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] gi|658017048|ref|XP_008343883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] Length = 604 Score = 85.9 bits (211), Expect = 5e-14 Identities = 41/73 (56%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+C +MSSVPHS LP+TY E+ S AR+K+I++KA MSD+LKTCS PR+ VK Sbjct: 520 QMAWKLCKMMSSVPHSTNLPDTYVRDEDASRARRKSIVQKAEAMSDLLKTCSDPRELVKF 579 Query: 842 RYLPKSGVSRADR 804 R P++ VSRA++ Sbjct: 580 RRSPENXVSRANQ 592 >gb|KHG09041.1| hypothetical protein F383_36318 [Gossypium arboreum] Length = 564 Score = 84.0 bits (206), Expect = 2e-13 Identities = 40/73 (54%), Positives = 56/73 (76%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA+K+CD+MSS+ SK+LPNTY ++ S AR+K+I++KA M+D+LKT PR+ VKH Sbjct: 476 EMARKLCDMMSSICSSKQLPNTYVGDKDSSRARRKSIIRKAEAMADMLKTSKDPRELVKH 535 Query: 842 RYLPKSGVSRADR 804 R L ++ VSRA R Sbjct: 536 RTLSENAVSRAGR 548 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 82.4 bits (202), Expect = 5e-13 Identities = 39/73 (53%), Positives = 54/73 (73%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA+K+CD+M+SVPHS KLPNTY + S ARK +I+++A MSD+LKTC+ PR+ VK Sbjct: 513 EMARKLCDMMASVPHSSKLPNTYSGDGDASRARKTSIIQRAEAMSDILKTCNDPRELVKR 572 Query: 842 RYLPKSGVSRADR 804 R ++ V AD+ Sbjct: 573 RSSFENTVLVADQ 585 >ref|XP_012451197.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Gossypium raimondii] gi|763797573|gb|KJB64528.1| hypothetical protein B456_010G053200 [Gossypium raimondii] gi|763797574|gb|KJB64529.1| hypothetical protein B456_010G053200 [Gossypium raimondii] Length = 567 Score = 81.6 bits (200), Expect = 9e-13 Identities = 39/73 (53%), Positives = 55/73 (75%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMA+K+CD+MS + SK+LPNTY E+ S AR+K+ ++KA M+D+LKT + PR+ VKH Sbjct: 479 EMARKLCDMMSLIRSSKQLPNTYVEDEDSSRARRKSTIRKAEAMADMLKTSTDPRELVKH 538 Query: 842 RYLPKSGVSRADR 804 R L ++ VSRA R Sbjct: 539 RTLSENAVSRAGR 551 >ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] gi|222854612|gb|EEE92159.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] Length = 607 Score = 80.9 bits (198), Expect = 2e-12 Identities = 39/74 (52%), Positives = 56/74 (75%), Gaps = 1/74 (1%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELS-HARKKTIMKKAVVMSDVLKTCSKPRKFVK 846 E+A+++C LMSSV HSK LPNTY + S HAR+K+I++KA VMS++LKTC+ PR+ VK Sbjct: 523 ELARRLCKLMSSVSHSKNLPNTYNVDRDASRHARRKSILQKAGVMSEILKTCNDPRELVK 582 Query: 845 HRYLPKSGVSRADR 804 HR ++ S A++ Sbjct: 583 HRSSSQNPESSANQ 596 >ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452173|ref|XP_009351091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452176|ref|XP_009351092.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452180|ref|XP_009351093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 80.5 bits (197), Expect = 2e-12 Identities = 39/73 (53%), Positives = 55/73 (75%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA+K+C +MSSVPHS LP+TY + S AR+K+I++KA MSD+LKTCS PR+ VK Sbjct: 524 QMARKLCKMMSSVPHSTNLPDTYVRDADASRARRKSIVQKAEAMSDLLKTCSDPRELVKF 583 Query: 842 RYLPKSGVSRADR 804 R P++ VS A++ Sbjct: 584 RRSPENLVSVANQ 596 >ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 80.5 bits (197), Expect = 2e-12 Identities = 39/73 (53%), Positives = 55/73 (75%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA+K+C +MSSVPHS LP+TY + S AR+K+I++KA MSD+LKTCS PR+ VK Sbjct: 524 QMARKLCKMMSSVPHSTNLPDTYVRDADASRARRKSIVQKAEAMSDLLKTCSDPRELVKF 583 Query: 842 RYLPKSGVSRADR 804 R P++ VS A++ Sbjct: 584 RRSPENLVSIANQ 596 >ref|XP_011081891.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Sesamum indicum] Length = 605 Score = 80.1 bits (196), Expect = 3e-12 Identities = 37/73 (50%), Positives = 51/73 (69%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 E +QK+ DLM SVPHS KLP+TY + SH RK +I+++A MSD+LKTC PR+ VKH Sbjct: 498 ETSQKLHDLMKSVPHSTKLPDTYKGYRNSSHERKISIIQRAEAMSDILKTCENPRELVKH 557 Query: 842 RYLPKSGVSRADR 804 + P++ V A + Sbjct: 558 KNRPENSVLSAQK 570 >ref|XP_012474396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Gossypium raimondii] gi|763756368|gb|KJB23699.1| hypothetical protein B456_004G110500 [Gossypium raimondii] Length = 592 Score = 78.6 bits (192), Expect = 8e-12 Identities = 38/71 (53%), Positives = 53/71 (74%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+C +MSS+ SKKLPNTYG E+ S AR+ +I + +SD+LKTC+ PR+ VKH Sbjct: 508 KMASKLCRIMSSIHSSKKLPNTYGGDEDSSQARRTSIKQ----LSDMLKTCNDPRELVKH 563 Query: 842 RYLPKSGVSRA 810 R+L ++ VSRA Sbjct: 564 RFLSENAVSRA 574 >ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Populus euphratica] Length = 607 Score = 78.2 bits (191), Expect = 1e-11 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 1/73 (1%) Frame = -1 Query: 1019 MAQKICDLMSSVPHSKKLPNTYGAHEELSH-ARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +AQ++C+LMSSV HSK LPNTY + S AR+K+I++KA VMS++LKTC+ PR+ VKH Sbjct: 524 LAQRLCNLMSSVSHSKNLPNTYNVDRDASRRARRKSILQKAGVMSEILKTCNDPRELVKH 583 Query: 842 RYLPKSGVSRADR 804 R ++ S A++ Sbjct: 584 RSSSQNPESSANQ 596 >gb|KHG18640.1| hypothetical protein F383_26294 [Gossypium arboreum] Length = 592 Score = 77.8 bits (190), Expect = 1e-11 Identities = 38/71 (53%), Positives = 51/71 (71%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 +MA K+C MSS+ SKKLPNTYG E+ S AR+ +I + +SD+LKTC+ PR+ VKH Sbjct: 508 KMASKLCGFMSSIHSSKKLPNTYGGDEDSSQARRTSIRQ----LSDMLKTCNDPRELVKH 563 Query: 842 RYLPKSGVSRA 810 R+L + VSRA Sbjct: 564 RFLSEDAVSRA 574 >gb|KHN10387.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 416 Score = 75.9 bits (185), Expect = 5e-11 Identities = 37/69 (53%), Positives = 49/69 (71%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMAQK+C LMSSVP+S LPNTYG E ++AR+K+I++KA SD+LK C P + KH Sbjct: 332 EMAQKLCKLMSSVPYSPNLPNTYGEVREDAYARRKSIIRKAKAFSDMLKDCKDPSELRKH 391 Query: 842 RYLPKSGVS 816 R ++ VS Sbjct: 392 RSSSENTVS 400 >ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like isoform X1 [Glycine max] gi|947055617|gb|KRH05070.1| hypothetical protein GLYMA_17G205100 [Glycine max] Length = 622 Score = 75.9 bits (185), Expect = 5e-11 Identities = 37/69 (53%), Positives = 49/69 (71%) Frame = -1 Query: 1022 EMAQKICDLMSSVPHSKKLPNTYGAHEELSHARKKTIMKKAVVMSDVLKTCSKPRKFVKH 843 EMAQK+C LMSSVP+S LPNTYG E ++AR+K+I++KA SD+LK C P + KH Sbjct: 538 EMAQKLCKLMSSVPYSPNLPNTYGEVREDAYARRKSIIRKAKAFSDMLKDCKDPSELRKH 597 Query: 842 RYLPKSGVS 816 R ++ VS Sbjct: 598 RSSSENTVS 606