BLASTX nr result
ID: Gardenia21_contig00003980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00003980 (510 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13812.1| unnamed protein product [Coffea canephora] 166 5e-39 >emb|CDP13812.1| unnamed protein product [Coffea canephora] Length = 128 Score = 166 bits (421), Expect = 5e-39 Identities = 80/97 (82%), Positives = 84/97 (86%), Gaps = 1/97 (1%) Frame = -2 Query: 290 MNGTSSLCPSVSIFPYNDLKPRISSTKLLWLSHLNKNEPATCGFLCIHKRNRILWVPTRA 111 MNG S CPS+SIFPYNDLKP ISSTKLLWLS +KNEPATCGFLC+HKRNR+ W PTR Sbjct: 1 MNGIGSQCPSISIFPYNDLKPPISSTKLLWLSKFSKNEPATCGFLCMHKRNRVFWFPTRV 60 Query: 110 TSAAPFLAAT-SPPNSGDFSVLFQTSAVMLLMYWIAN 3 TSA FLAAT PPNSGDFSVLFQTSAVMLLMYWIAN Sbjct: 61 TSAPLFLAATLPPPNSGDFSVLFQTSAVMLLMYWIAN 97