BLASTX nr result
ID: Gardenia21_contig00003845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00003845 (952 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00506.1| unnamed protein product [Coffea canephora] 44 4e-07 >emb|CDP00506.1| unnamed protein product [Coffea canephora] Length = 554 Score = 43.9 bits (102), Expect(3) = 4e-07 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -3 Query: 653 LFKRGRE-LARIKKWNCGKNSLRIVEGMEFDHGYI 552 L K GR+ + RI+K N G+NSLRIVEGMEFD GY+ Sbjct: 166 LQKVGRKGVVRIEKGNHGENSLRIVEGMEFDRGYL 200 Score = 30.0 bits (66), Expect(3) = 4e-07 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 720 DFANVAIVRAGNDYVAGKMSSDTFQK 643 + +VA V AGNDY G M S+ QK Sbjct: 143 ELVDVAAVSAGNDYAVGNMISNALQK 168 Score = 27.7 bits (60), Expect(3) = 4e-07 Identities = 29/67 (43%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = -1 Query: 466 NC-FWLPEIKNTKLKDMF*D-----DRKCPIVIVA*NIEEGALAP----SLKG---SCAT 326 NC L + K T K+MF K PIVIVA IE+ ALAP LKG + A Sbjct: 217 NCKLLLVDKKITNAKEMFKILDNAVKEKYPIVIVAEGIEQEALAPVVRNKLKGTLKAVAI 276 Query: 325 RGLAFTE 305 R AF E Sbjct: 277 RAPAFGE 283