BLASTX nr result
ID: Gardenia21_contig00003741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00003741 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99830.1| unnamed protein product [Coffea canephora] 63 7e-08 >emb|CDO99830.1| unnamed protein product [Coffea canephora] Length = 375 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 506 SISSRMRTRLSGEDPYLTMNERTIIRQFLEACPGEE 399 SISSR+R RLSGEDP LT NERTIIRQFLEACP EE Sbjct: 340 SISSRIRKRLSGEDPNLTKNERTIIRQFLEACPDEE 375