BLASTX nr result
ID: Gardenia21_contig00003476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00003476 (425 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10079.1| unnamed protein product [Coffea canephora] 66 9e-09 >emb|CDP10079.1| unnamed protein product [Coffea canephora] Length = 108 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/67 (47%), Positives = 44/67 (65%) Frame = +2 Query: 131 VAQQSENREEQRAGNESGGHRQRESSSFLRRRCRGEAHLLGGSRHHGQHHDSSEYQGLDR 310 + Q++NR EQR G++SGGH QR+ S +RRRCRG+A+L +GQ HD ++Q LD Sbjct: 17 IPHQTKNRGEQRRGDQSGGHWQRKPGSGIRRRCRGQAYLFSRGGSNGQ-HDDCQHQSLDH 75 Query: 311 ANLRSHL 331 NL L Sbjct: 76 TNLSHFL 82