BLASTX nr result
ID: Gardenia21_contig00003339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00003339 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07965.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP07965.1| unnamed protein product [Coffea canephora] Length = 680 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 127 LTIGPSSGNHETASVALSKARLDPQSAVSTQVASYRELQKKV 2 L G SSGNH T SVAL+KARLD QSAVSTQV S RE QKKV Sbjct: 95 LKTGSSSGNHGTVSVALTKARLDSQSAVSTQVFSDREFQKKV 136