BLASTX nr result
ID: Gardenia21_contig00001240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00001240 (419 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14163.1| unnamed protein product [Coffea canephora] 62 1e-07 >emb|CDP14163.1| unnamed protein product [Coffea canephora] Length = 102 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 417 ELKQLNAENAKLQYCITHLVRTLKDADCMLQSK 319 ELKQLNAENAKLQY ITHLVR +KDADCMLQSK Sbjct: 70 ELKQLNAENAKLQYRITHLVRAVKDADCMLQSK 102