BLASTX nr result
ID: Gardenia21_contig00000611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00000611 (447 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01054.1| unnamed protein product [Coffea canephora] 110 4e-22 >emb|CDP01054.1| unnamed protein product [Coffea canephora] Length = 417 Score = 110 bits (275), Expect = 4e-22 Identities = 55/69 (79%), Positives = 57/69 (82%) Frame = -2 Query: 209 MQRAGLAKATDKNPNSSRTVFIGGIFLDNTISSSILDTIFSKTTDSDDSHFSVCYQKRKP 30 M AGLAKAT KNPN VFIGGIFLDNTISSSILD I SKTT SDD HFS+ YQK+KP Sbjct: 1 MPGAGLAKATHKNPNCKEIVFIGGIFLDNTISSSILDAISSKTTHSDDPHFSISYQKKKP 60 Query: 29 LFKFPAVKG 3 LFKFPAVKG Sbjct: 61 LFKFPAVKG 69