BLASTX nr result
ID: Gardenia21_contig00000499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00000499 (438 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223861.1| hypothetical protein PRUPE_ppa014171mg [Prun... 56 9e-06 >ref|XP_007223861.1| hypothetical protein PRUPE_ppa014171mg [Prunus persica] gi|462420797|gb|EMJ25060.1| hypothetical protein PRUPE_ppa014171mg [Prunus persica] Length = 82 Score = 56.2 bits (134), Expect = 9e-06 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 8/69 (11%) Frame = -3 Query: 385 RWHRSRLRNQLVLKLNHQLGRLRKSL--------PKLQPPNQPLRRPSRSLGSQGKRYQV 230 +WH SRLRN +L LN GR RK+L P+L+PPNQPLRR S+SLGS +R + Sbjct: 17 KWHHSRLRN--LLALNPLQGRPRKNLLPKLVAPRPELRPPNQPLRRLSQSLGSLRRRQRE 74 Query: 229 ASQLQQRTK 203 AS LQ R + Sbjct: 75 AS-LQPRIR 82