BLASTX nr result
ID: Forsythia23_contig00035796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035796 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007155126.1| hypothetical protein PHAVU_003G1757001g, par... 59 1e-06 ref|XP_010323153.1| PREDICTED: dicer-like protein 4 isoform X3 [... 59 2e-06 ref|XP_010323152.1| PREDICTED: dicer-like protein 4 isoform X2 [... 59 2e-06 ref|XP_010323151.1| PREDICTED: dicer-like protein 4 isoform X1 [... 59 2e-06 ref|XP_009765935.1| PREDICTED: dicer-like protein 4 isoform X2 [... 59 2e-06 ref|XP_009765934.1| PREDICTED: dicer-like protein 4 isoform X1 [... 59 2e-06 ref|XP_009597854.1| PREDICTED: dicer-like protein 4 [Nicotiana t... 59 2e-06 ref|XP_006343692.1| PREDICTED: dicer-like protein 4-like isoform... 59 2e-06 ref|XP_006343691.1| PREDICTED: dicer-like protein 4-like isoform... 59 2e-06 ref|XP_006343690.1| PREDICTED: dicer-like protein 4-like isoform... 59 2e-06 ref|NP_001266210.1| dicer-like protein 4 [Solanum lycopersicum] ... 59 2e-06 gb|AFD22621.1| dicer-like 4 protein [Nicotiana attenuata] 59 2e-06 gb|KHN18588.1| Dicer-like protein 4 [Glycine soja] 58 2e-06 ref|XP_003550797.1| PREDICTED: dicer-like protein 4-like isoform... 58 2e-06 ref|XP_012573521.1| PREDICTED: dicer-like protein 4 [Cicer ariet... 58 3e-06 ref|XP_008663381.1| PREDICTED: endoribonuclease Dicer homolog 4 ... 58 3e-06 gb|AFW58820.1| hypothetical protein ZEAMMB73_649074, partial [Ze... 58 3e-06 ref|XP_011078684.1| PREDICTED: dicer-like protein 4 isoform X2 [... 57 4e-06 emb|CDP10524.1| unnamed protein product [Coffea canephora] 57 5e-06 gb|AIE15766.1| Dicer-like protein 4a [Salvia miltiorrhiza] 56 8e-06 >ref|XP_007155126.1| hypothetical protein PHAVU_003G1757001g, partial [Phaseolus vulgaris] gi|561028480|gb|ESW27120.1| hypothetical protein PHAVU_003G1757001g, partial [Phaseolus vulgaris] Length = 1443 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 304 LG*YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +G Y+VLVMTPQILLHNLSHCFI +E+IALLIF Sbjct: 141 IGQYEVLVMTPQILLHNLSHCFITMEVIALLIF 173 >ref|XP_010323153.1| PREDICTED: dicer-like protein 4 isoform X3 [Solanum lycopersicum] Length = 1588 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 112 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 141 >ref|XP_010323152.1| PREDICTED: dicer-like protein 4 isoform X2 [Solanum lycopersicum] Length = 1610 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 134 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 163 >ref|XP_010323151.1| PREDICTED: dicer-like protein 4 isoform X1 [Solanum lycopersicum] Length = 1621 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 145 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 174 >ref|XP_009765935.1| PREDICTED: dicer-like protein 4 isoform X2 [Nicotiana sylvestris] Length = 1623 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 148 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 177 >ref|XP_009765934.1| PREDICTED: dicer-like protein 4 isoform X1 [Nicotiana sylvestris] Length = 1624 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 148 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 177 >ref|XP_009597854.1| PREDICTED: dicer-like protein 4 [Nicotiana tomentosiformis] Length = 1399 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 207 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 236 >ref|XP_006343692.1| PREDICTED: dicer-like protein 4-like isoform X3 [Solanum tuberosum] Length = 1342 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 145 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 174 >ref|XP_006343691.1| PREDICTED: dicer-like protein 4-like isoform X2 [Solanum tuberosum] Length = 1621 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 145 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 174 >ref|XP_006343690.1| PREDICTED: dicer-like protein 4-like isoform X1 [Solanum tuberosum] Length = 1622 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 145 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 174 >ref|NP_001266210.1| dicer-like protein 4 [Solanum lycopersicum] gi|397529815|gb|AFO53518.1| dicer-like protein 4 [Solanum lycopersicum] Length = 1620 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 145 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 174 >gb|AFD22621.1| dicer-like 4 protein [Nicotiana attenuata] Length = 1622 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHC+IRIE IALLIF Sbjct: 148 YEVLVMTPQILLHNLSHCYIRIEFIALLIF 177 >gb|KHN18588.1| Dicer-like protein 4 [Glycine soja] Length = 1592 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 304 LG*YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +G Y+VLVMTPQILLHNLSHCFI +E+IALLIF Sbjct: 144 IGQYEVLVMTPQILLHNLSHCFITMEMIALLIF 176 >ref|XP_003550797.1| PREDICTED: dicer-like protein 4-like isoform X1 [Glycine max] Length = 1636 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 304 LG*YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +G Y+VLVMTPQILLHNLSHCFI +E+IALLIF Sbjct: 144 IGQYEVLVMTPQILLHNLSHCFITMEMIALLIF 176 >ref|XP_012573521.1| PREDICTED: dicer-like protein 4 [Cicer arietinum] Length = 1626 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHCFI++E+IALLIF Sbjct: 141 YEVLVMTPQILLHNLSHCFIKMEMIALLIF 170 >ref|XP_008663381.1| PREDICTED: endoribonuclease Dicer homolog 4 [Zea mays] Length = 1056 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 304 LG*YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +G Y+VLVMTPQILLHNL HCFIR+++IALLIF Sbjct: 119 MGEYEVLVMTPQILLHNLRHCFIRMDLIALLIF 151 >gb|AFW58820.1| hypothetical protein ZEAMMB73_649074, partial [Zea mays] Length = 237 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 304 LG*YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +G Y+VLVMTPQILLHNL HCFIR+++IALLIF Sbjct: 119 MGEYEVLVMTPQILLHNLRHCFIRMDLIALLIF 151 >ref|XP_011078684.1| PREDICTED: dicer-like protein 4 isoform X2 [Sesamum indicum] Length = 1639 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 Y+VLVMTPQILLHNLSHCFI+IE I+LLIF Sbjct: 145 YEVLVMTPQILLHNLSHCFIKIEFISLLIF 174 >emb|CDP10524.1| unnamed protein product [Coffea canephora] Length = 1655 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +1 Query: 313 YKVLVMTPQILLHNLSHCFIRIEIIALLIF 402 +++LVMTPQILLHNLSHCFI+IE+IALLIF Sbjct: 164 HEILVMTPQILLHNLSHCFIKIELIALLIF 193 >gb|AIE15766.1| Dicer-like protein 4a [Salvia miltiorrhiza] Length = 1628 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +1 Query: 316 KVLVMTPQILLHNLSHCFIRIEIIALLIF 402 ++LVMTPQILLHNLSHCFI+IE+IALLIF Sbjct: 141 EILVMTPQILLHNLSHCFIKIELIALLIF 169