BLASTX nr result
ID: Forsythia23_contig00035746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035746 (377 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010271416.1| PREDICTED: peptide methionine sulfoxide redu... 71 2e-10 ref|XP_010271415.1| PREDICTED: peptide methionine sulfoxide redu... 71 2e-10 ref|NP_179394.1| peptide methionine sulfoxide reductase A5 [Arab... 70 4e-10 ref|XP_009112464.1| PREDICTED: peptide methionine sulfoxide redu... 69 9e-10 emb|CDY30332.1| BnaA09g09450D [Brassica napus] 69 9e-10 ref|XP_011099820.1| PREDICTED: peptide methionine sulfoxide redu... 69 1e-09 ref|XP_011099818.1| PREDICTED: peptide methionine sulfoxide redu... 69 1e-09 ref|XP_011013667.1| PREDICTED: peptide methionine sulfoxide redu... 69 2e-09 ref|XP_011025944.1| PREDICTED: peptide methionine sulfoxide redu... 69 2e-09 ref|XP_011025943.1| PREDICTED: peptide methionine sulfoxide redu... 69 2e-09 ref|XP_006409206.1| hypothetical protein EUTSA_v10022823mg [Eutr... 69 2e-09 ref|XP_002310304.2| peptide methionine sulfoxide reductase famil... 69 2e-09 ref|XP_008222452.1| PREDICTED: peptide methionine sulfoxide redu... 68 2e-09 ref|XP_007046726.1| Peptide methionine sulfoxide reductase famil... 68 2e-09 ref|XP_009368189.1| PREDICTED: peptide methionine sulfoxide redu... 68 3e-09 ref|XP_008363745.1| PREDICTED: peptide methionine sulfoxide redu... 68 3e-09 ref|XP_007227545.1| hypothetical protein PRUPE_ppa010381mg [Prun... 68 3e-09 ref|XP_010467607.1| PREDICTED: peptide methionine sulfoxide redu... 67 4e-09 ref|XP_010413128.1| PREDICTED: peptide methionine sulfoxide redu... 67 4e-09 ref|XP_006298388.1| hypothetical protein CARUB_v10014459mg [Caps... 67 4e-09 >ref|XP_010271416.1| PREDICTED: peptide methionine sulfoxide reductase A5 isoform X2 [Nelumbo nucifera] Length = 238 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR QR IDA+INDIL KGWPILRDV Sbjct: 203 KLNGYAAELCPPRTQRQIDAKINDILRKGWPILRDV 238 >ref|XP_010271415.1| PREDICTED: peptide methionine sulfoxide reductase A5 isoform X1 [Nelumbo nucifera] Length = 250 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR QR IDA+INDIL KGWPILRDV Sbjct: 215 KLNGYAAELCPPRTQRQIDAKINDILRKGWPILRDV 250 >ref|NP_179394.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] gi|75266015|sp|Q9SL43.1|MSRA5_ARATH RecName: Full=Peptide methionine sulfoxide reductase A5; Short=AtMSRA5; AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; AltName: Full=Protein-methionine-S-oxide reductase; Flags: Precursor gi|4406815|gb|AAD20123.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|27765030|gb|AAO23636.1| At2g18030 [Arabidopsis thaliana] gi|110742978|dbj|BAE99383.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|330251624|gb|AEC06718.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] Length = 254 Score = 70.5 bits (171), Expect = 4e-10 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+HID+R+N+I+ KGWP+LRD+ Sbjct: 219 KLNGYAAELCPPRIQKHIDSRVNEIIRKGWPVLRDI 254 >ref|XP_009112464.1| PREDICTED: peptide methionine sulfoxide reductase A5 [Brassica rapa] Length = 250 Score = 69.3 bits (168), Expect = 9e-10 Identities = 26/36 (72%), Positives = 35/36 (97%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+HID+R+N+I+ KGWP+L+D+ Sbjct: 215 KLNGYAAELCPPRVQKHIDSRVNEIIRKGWPVLKDI 250 >emb|CDY30332.1| BnaA09g09450D [Brassica napus] Length = 250 Score = 69.3 bits (168), Expect = 9e-10 Identities = 26/36 (72%), Positives = 35/36 (97%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+HID+R+N+I+ KGWP+L+D+ Sbjct: 215 KLNGYAAELCPPRVQKHIDSRVNEIIRKGWPVLKDI 250 >ref|XP_011099820.1| PREDICTED: peptide methionine sulfoxide reductase A5 isoform X3 [Sesamum indicum] Length = 230 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPRMQR IDA+I+DI+ KGWPILR++ Sbjct: 195 KLNGYAAELCPPRMQRQIDAKIDDIIRKGWPILREI 230 >ref|XP_011099818.1| PREDICTED: peptide methionine sulfoxide reductase A5 isoform X1 [Sesamum indicum] Length = 244 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPRMQR IDA+I+DI+ KGWPILR++ Sbjct: 209 KLNGYAAELCPPRMQRQIDAKIDDIIRKGWPILREI 244 >ref|XP_011013667.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Populus euphratica] Length = 252 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ I+A+INDIL KGWP+LRDV Sbjct: 217 KLNGYAAELCPPRIQKQINAKINDILRKGWPVLRDV 252 >ref|XP_011025944.1| PREDICTED: peptide methionine sulfoxide reductase A5-like isoform X2 [Populus euphratica] Length = 252 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ I+A+INDIL KGWP+LRDV Sbjct: 217 KLNGYAAELCPPRIQKQINAKINDILRKGWPVLRDV 252 >ref|XP_011025943.1| PREDICTED: peptide methionine sulfoxide reductase A5-like isoform X1 [Populus euphratica] Length = 252 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ I+A+INDIL KGWP+LRDV Sbjct: 217 KLNGYAAELCPPRIQKQINAKINDILRKGWPVLRDV 252 >ref|XP_006409206.1| hypothetical protein EUTSA_v10022823mg [Eutrema salsugineum] gi|557110368|gb|ESQ50659.1| hypothetical protein EUTSA_v10022823mg [Eutrema salsugineum] Length = 254 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ IDAR+N+I+ KGWP+LRD+ Sbjct: 219 KLNGYAAELCPPRIQKQIDARVNEIIRKGWPVLRDI 254 >ref|XP_002310304.2| peptide methionine sulfoxide reductase family protein [Populus trichocarpa] gi|118489617|gb|ABK96610.1| unknown [Populus trichocarpa x Populus deltoides] gi|550334845|gb|EEE90754.2| peptide methionine sulfoxide reductase family protein [Populus trichocarpa] Length = 252 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ I+A+INDIL KGWP+LRDV Sbjct: 217 KLNGYAAELCPPRIQKQINAKINDILRKGWPVLRDV 252 >ref|XP_008222452.1| PREDICTED: peptide methionine sulfoxide reductase A5 [Prunus mume] Length = 274 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV*YGILHVEVDT 235 KLNGYAAELCPP++QR IDA+IN+I+ KGWPILRD+ +L V + Sbjct: 217 KLNGYAAELCPPKIQRQIDAKINEIIKKGWPILRDLFVDLLRCIVSS 263 >ref|XP_007046726.1| Peptide methionine sulfoxide reductase family protein [Theobroma cacao] gi|508698987|gb|EOX90883.1| Peptide methionine sulfoxide reductase family protein [Theobroma cacao] Length = 251 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ IDA+IN+I+ KGWP+LRDV Sbjct: 216 KLNGYAAELCPPRIQKQIDAKINEIIRKGWPVLRDV 251 >ref|XP_009368189.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Pyrus x bretschneideri] gi|694384602|ref|XP_009368190.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Pyrus x bretschneideri] gi|694384605|ref|XP_009368191.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Pyrus x bretschneideri] gi|694384607|ref|XP_009368192.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Pyrus x bretschneideri] Length = 252 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPP++QR IDA+IN+I+ KGWPILRD+ Sbjct: 217 KLNGYAAELCPPKIQRQIDAKINEIIKKGWPILRDL 252 >ref|XP_008363745.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Malus domestica] gi|658055988|ref|XP_008363746.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Malus domestica] Length = 252 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPP++QR IDA+IN+I+ KGWPILRD+ Sbjct: 217 KLNGYAAELCPPKIQRQIDAKINEIIKKGWPILRDL 252 >ref|XP_007227545.1| hypothetical protein PRUPE_ppa010381mg [Prunus persica] gi|462424481|gb|EMJ28744.1| hypothetical protein PRUPE_ppa010381mg [Prunus persica] Length = 252 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPP++QR IDA+IN+I+ KGWPILRD+ Sbjct: 217 KLNGYAAELCPPKIQRQIDAKINEIIKKGWPILRDL 252 >ref|XP_010467607.1| PREDICTED: peptide methionine sulfoxide reductase A5 [Camelina sativa] Length = 258 Score = 67.4 bits (163), Expect = 4e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ ID+R+N+I+ KGWP+LRD+ Sbjct: 223 KLNGYAAELCPPRIQKQIDSRVNEIIRKGWPVLRDI 258 >ref|XP_010413128.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Camelina sativa] Length = 260 Score = 67.4 bits (163), Expect = 4e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ ID+R+N+I+ KGWP+LRD+ Sbjct: 225 KLNGYAAELCPPRIQKQIDSRVNEIIRKGWPVLRDI 260 >ref|XP_006298388.1| hypothetical protein CARUB_v10014459mg [Capsella rubella] gi|482567097|gb|EOA31286.1| hypothetical protein CARUB_v10014459mg [Capsella rubella] Length = 253 Score = 67.4 bits (163), Expect = 4e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 375 KLNGYAAELCPPRMQRHIDARINDILSKGWPILRDV 268 KLNGYAAELCPPR+Q+ ID+R+N+I+ KGWP+LRD+ Sbjct: 218 KLNGYAAELCPPRIQKQIDSRVNEIIRKGWPVLRDI 253