BLASTX nr result
ID: Forsythia23_contig00027933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00027933 (361 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093042.1| PREDICTED: uncharacterized protein LOC105173... 57 6e-06 >ref|XP_011093042.1| PREDICTED: uncharacterized protein LOC105173090 [Sesamum indicum] Length = 1351 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 359 QLESGSVGPVGFPGTNEQSQMSEGSRARTFEHRRFH 252 QLE GS+GPVG PG +EQSQ++EG+RARTFE R H Sbjct: 1295 QLEFGSLGPVGLPGMDEQSQLNEGTRARTFEDHRLH 1330