BLASTX nr result
ID: Forsythia22_contig00061143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00061143 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852790.1| PREDICTED: BTB/POZ domain-containing protein... 91 3e-16 ref|XP_011099250.1| PREDICTED: BTB/POZ domain-containing protein... 89 1e-15 ref|XP_008241595.1| PREDICTED: BTB/POZ domain-containing protein... 86 1e-14 ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prun... 86 1e-14 ref|XP_011016336.1| PREDICTED: BTB/POZ domain-containing protein... 85 2e-14 ref|XP_010909562.1| PREDICTED: BTB/POZ domain-containing protein... 85 2e-14 ref|XP_008792644.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 85 2e-14 gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] 84 3e-14 gb|KEH20466.1| phototropic-responsive NPH3 family protein [Medic... 84 3e-14 ref|XP_010070467.1| PREDICTED: BTB/POZ domain-containing protein... 84 3e-14 ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phas... 84 3e-14 ref|XP_002310186.2| hypothetical protein POPTR_0007s12050g [Popu... 84 3e-14 ref|XP_007047096.1| Phototropic-responsive NPH3 family protein i... 84 3e-14 ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein... 84 3e-14 ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein... 84 3e-14 ref|XP_003636081.1| Root phototropism protein [Medicago truncatu... 84 3e-14 ref|XP_007047097.1| Phototropic-responsive NPH3 family protein i... 84 4e-14 ref|XP_012469496.1| PREDICTED: BTB/POZ domain-containing protein... 84 5e-14 ref|XP_011025673.1| PREDICTED: BTB/POZ domain-containing protein... 84 5e-14 ref|XP_010484625.1| PREDICTED: BTB/POZ domain-containing protein... 84 5e-14 >ref|XP_012852790.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Erythranthe guttatus] gi|604345831|gb|EYU44328.1| hypothetical protein MIMGU_mgv1a002439mg [Erythranthe guttata] Length = 675 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 143 RQMASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 R+MA+EKPSSKGQAWFCTT LPSDVIIEVD M FHLHKFPLMSKSRK Sbjct: 4 RKMAAEKPSSKGQAWFCTTGLPSDVIIEVDDMTFHLHKFPLMSKSRK 50 >ref|XP_011099250.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Sesamum indicum] Length = 668 Score = 88.6 bits (218), Expect = 1e-15 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+EKPSSKGQAWFCTT LPSDVIIEVD M FHLHKFPLMSKSRK Sbjct: 1 MAAEKPSSKGQAWFCTTGLPSDVIIEVDDMTFHLHKFPLMSKSRK 45 >ref|XP_008241595.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Prunus mume] Length = 685 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 A+EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 7 AAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 50 >ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] gi|462399384|gb|EMJ05052.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] Length = 684 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 A+EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 7 AAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 50 >ref|XP_011016336.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] gi|743943654|ref|XP_011016337.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] Length = 662 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+E+PSSKGQAWFCTT LPSD++IEV+ M FHLHKFPLMSKSRK Sbjct: 1 MAAEQPSSKGQAWFCTTGLPSDIVIEVEDMTFHLHKFPLMSKSRK 45 >ref|XP_010909562.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Elaeis guineensis] Length = 674 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+EKP SKGQAWFCTT LPSDV+IEVD M FHLHKFPLMSKS+K Sbjct: 14 MATEKPGSKGQAWFCTTGLPSDVVIEVDEMSFHLHKFPLMSKSKK 58 >ref|XP_008792644.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At5g66560-like, partial [Phoenix dactylifera] Length = 582 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+EKP SKGQAWFCTT LPSDV+IEVD M FHLHKFPLMSKS+K Sbjct: 22 MAAEKPGSKGQAWFCTTGLPSDVVIEVDEMSFHLHKFPLMSKSKK 66 >gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] Length = 616 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >gb|KEH20466.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 464 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >ref|XP_010070467.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Eucalyptus grandis] gi|629093266|gb|KCW59261.1| hypothetical protein EUGRSUZ_H01939 [Eucalyptus grandis] Length = 704 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+EK SSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 1 MAAEKTSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 45 >ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|593785903|ref|XP_007155992.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029345|gb|ESW27985.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029346|gb|ESW27986.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] Length = 649 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >ref|XP_002310186.2| hypothetical protein POPTR_0007s12050g [Populus trichocarpa] gi|550334708|gb|EEE90636.2| hypothetical protein POPTR_0007s12050g [Populus trichocarpa] Length = 715 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -1 Query: 149 LYRQMASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 L +MA+EKP SKGQAWFCTT LPSD++IEV M FHLHKFPLMSKSRK Sbjct: 57 LKTKMAAEKPGSKGQAWFCTTGLPSDIVIEVGDMTFHLHKFPLMSKSRK 105 >ref|XP_007047096.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] gi|508699357|gb|EOX91253.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] Length = 778 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 140 QMASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 +MA++KPSSKGQAWFC T LPSD++IEVD M FHLHKFPLMSKSRK Sbjct: 99 KMAADKPSSKGQAWFCATGLPSDIMIEVDDMTFHLHKFPLMSKSRK 144 >ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] Length = 648 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] Length = 655 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >ref|XP_003636081.1| Root phototropism protein [Medicago truncatula] gi|657375041|gb|KEH20464.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 661 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 ASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 ++EKPSSKGQAWFCTT LPSD+++EVD M FHLHKFPLMSKSRK Sbjct: 3 SAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRK 46 >ref|XP_007047097.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] gi|508699358|gb|EOX91254.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] Length = 644 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA++KPSSKGQAWFC T LPSD++IEVD M FHLHKFPLMSKSRK Sbjct: 1 MAADKPSSKGQAWFCATGLPSDIMIEVDDMTFHLHKFPLMSKSRK 45 >ref|XP_012469496.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Gossypium raimondii] gi|763750463|gb|KJB17851.1| hypothetical protein B456_003G019200 [Gossypium raimondii] gi|763750464|gb|KJB17852.1| hypothetical protein B456_003G019200 [Gossypium raimondii] Length = 677 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA++KPSSKGQAWFC T LPSD+IIEVD M FHLHKFPL+SKSRK Sbjct: 1 MAADKPSSKGQAWFCATGLPSDIIIEVDDMTFHLHKFPLISKSRK 45 >ref|XP_011025673.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] Length = 656 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MA+E+PSSKGQAWFCTT LPSD++IEV+ M FHLHKFPLMSKS+K Sbjct: 1 MAAEQPSSKGQAWFCTTGLPSDIVIEVEDMTFHLHKFPLMSKSKK 45 >ref|XP_010484625.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Camelina sativa] Length = 670 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 137 MASEKPSSKGQAWFCTTSLPSDVIIEVDGMIFHLHKFPLMSKSRK 3 MASEK SSKGQAWFCTT LPSD+ IEVD M FHLHKFPLMSKSRK Sbjct: 1 MASEKSSSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRK 45