BLASTX nr result
ID: Forsythia22_contig00061132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00061132 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090370.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_012850802.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_011090370.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Sesamum indicum] Length = 701 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/62 (50%), Positives = 37/62 (59%) Frame = -3 Query: 187 MLALFFLKSRQHCTLKPFSKHPYFSLVSLHTRTLLPHRNKPKINENATTNKWNTTHTFVL 8 ML+L L Q CT KP S LHT +LLP RNKPK + + T + WNTTH FVL Sbjct: 1 MLSLLILGFHQRCTRKPLSDPSKLFPFRLHTLSLLPRRNKPKKHSDVTASTWNTTHRFVL 60 Query: 7 SN 2 +N Sbjct: 61 AN 62 >ref|XP_012850802.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial [Erythranthe guttatus] Length = 697 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -3 Query: 187 MLALFFLKSRQHCTL-KPFSKHPYFSLVSLHTRTLLPHRNKPKINENATTNKWNTTHTFV 11 ML+LF L + C + KPF K F L HT +LLP RNK K + N + N WNTTH FV Sbjct: 1 MLSLFILSPGKRCRINKPFFKLRQFHL---HTLSLLPKRNKLKKHSNISANNWNTTHKFV 57 Query: 10 LSN 2 LSN Sbjct: 58 LSN 60