BLASTX nr result
ID: Forsythia22_contig00060633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00060633 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073278.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_006485061.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_006436989.1| hypothetical protein CICLE_v10033340mg, part... 69 2e-09 ref|XP_012856828.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 gb|EYU21769.1| hypothetical protein MIMGU_mgv1a020844mg [Erythra... 67 4e-09 ref|XP_010099533.1| hypothetical protein L484_011606 [Morus nota... 67 6e-09 ref|XP_009360276.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_008375427.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_004309485.2| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_010318680.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 emb|CDO98289.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_006341456.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_011073278.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 [Sesamum indicum] Length = 569 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFE 168 R+LRD R G KK AGCS I+L+G+ HEFVSGDCLHPHT+DI VLN LE HQ+E Sbjct: 514 RRLRDSRCGIKKIAGCSLIELDGITHEFVSGDCLHPHTEDIYFVLNGLELHQYE 567 >ref|XP_006485061.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like [Citrus sinensis] Length = 523 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 299 KKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEAF 162 KKNAGCS IQLNGV HEFVSGD LHP +D+I ++L+ + HQ E+F Sbjct: 478 KKNAGCSLIQLNGVMHEFVSGDSLHPDSDEIYLILDGISTHQLESF 523 >ref|XP_006436989.1| hypothetical protein CICLE_v10033340mg, partial [Citrus clementina] gi|557539185|gb|ESR50229.1| hypothetical protein CICLE_v10033340mg, partial [Citrus clementina] Length = 527 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 299 KKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEAF 162 KKNAGCS IQLNGV HEFVSGD LHP +D+I ++L+ + HQ E+F Sbjct: 482 KKNAGCSLIQLNGVMHEFVSGDSLHPDSDEIYLILDGINTHQLESF 527 >ref|XP_012856828.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 [Erythranthe guttatus] Length = 546 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFE 168 R+LRD R G KK+AG S I+L GV HEFVSGDCLH T +I VLN LE +Q+E Sbjct: 491 RRLRDCRWGIKKSAGVSLIELGGVAHEFVSGDCLHDCTFEIYSVLNGLELNQYE 544 >gb|EYU21769.1| hypothetical protein MIMGU_mgv1a020844mg [Erythranthe guttata] Length = 393 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFE 168 R+LRD R G KK+AG S I+L GV HEFVSGDCLH T +I VLN LE +Q+E Sbjct: 338 RRLRDCRWGIKKSAGVSLIELGGVAHEFVSGDCLHDCTFEIYSVLNGLELNQYE 391 >ref|XP_010099533.1| hypothetical protein L484_011606 [Morus notabilis] gi|587890772|gb|EXB79413.1| hypothetical protein L484_011606 [Morus notabilis] Length = 567 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEAF 162 R+ +D + K+NAGCS I+L GV+HEFV+GD LHP + +I +LN +E HQ EAF Sbjct: 512 RRWKDSKRAVKRNAGCSLIRLGGVSHEFVAGDDLHPQSHEIYSLLNGIEKHQLEAF 567 >ref|XP_009360276.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like [Pyrus x bretschneideri] gi|694361000|ref|XP_009360290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like [Pyrus x bretschneideri] Length = 530 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 299 KKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEA 165 KK +GCS I+L+GV HEF++GDCLHP T+ I +VLN L+ HQFEA Sbjct: 485 KKISGCSLIRLDGVTHEFIAGDCLHPKTEAIYLVLNGLQKHQFEA 529 >ref|XP_008375427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 [Malus domestica] Length = 530 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 299 KKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEA 165 KK +GCS I+L GV HEF++GDCLHP T+ I +VLN L+ HQFEA Sbjct: 485 KKISGCSLIRLEGVTHEFIAGDCLHPKTEAIYLVLNGLQKHQFEA 529 >ref|XP_004309485.2| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 [Fragaria vesca subsp. vesca] Length = 527 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 299 KKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFEA 165 KKN GCS I+LNG NHEF++GD LHP T+ I VL+ L HQFE+ Sbjct: 482 KKNNGCSLIRLNGTNHEFLAGDSLHPQTEAIYFVLDGLWKHQFES 526 >ref|XP_010318680.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 [Solanum lycopersicum] Length = 531 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLE 183 R+ RD R+ KK+AGCS IQLNGV HEF+S D LHP ++DI I+LN L+ Sbjct: 477 RRKRD-RVKIKKSAGCSLIQLNGVTHEFISWDDLHPQSNDIYIILNCLQ 524 >emb|CDO98289.1| unnamed protein product [Coffea canephora] Length = 532 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLECHQFE 168 R+L D R K+AGCS IQLNGV+HEFV+GD HP ++I +VLN LE H+ E Sbjct: 477 RRLSD-RTRVNKSAGCSLIQLNGVSHEFVAGDDAHPLAEEIHLVLNVLEQHKSE 529 >ref|XP_006341456.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like [Solanum tuberosum] Length = 531 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -1 Query: 329 RKLRDYRLGTKKNAGCSCIQLNGVNHEFVSGDCLHPHTDDICIVLNRLE 183 R+ RD R+ KK+AGCS IQLNGV HEF+S D LHP D+I +LN L+ Sbjct: 477 RRKRD-RVKIKKSAGCSLIQLNGVAHEFISWDDLHPQNDEIYSILNCLQ 524