BLASTX nr result
ID: Forsythia22_contig00060384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00060384 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222366.1| hypothetical protein BevumaM_p133 [Beta vulg... 56 3e-12 gb|KJB06854.1| hypothetical protein B456_001G165200 [Gossypium r... 65 2e-08 >ref|YP_004222366.1| hypothetical protein BevumaM_p133 [Beta vulgaris subsp. maritima] gi|346683239|ref|YP_004842171.1| hypothetical protein BemaM_p127 [Beta macrocarpa] gi|317905598|emb|CBX33217.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439881|emb|CBX33312.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148035|emb|CBJ20699.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500157|emb|CBX24976.1| hypothetical protein [Beta macrocarpa] gi|384977917|emb|CBL54141.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 125 Score = 56.2 bits (134), Expect(2) = 3e-12 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +2 Query: 206 GTEPARGGFTIQCFDPLGYIHPYPHKGLSL 295 G EPARGGFTI C DPLGYI PYP GLSL Sbjct: 29 GIEPARGGFTIHCLDPLGYIRPYPRTGLSL 58 Score = 41.6 bits (96), Expect(2) = 3e-12 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 132 LQKKFFLGLSCFSETNGPFINGRTWGLNP 218 L KK FLGL C TNGPFI+GRT G+ P Sbjct: 4 LLKKCFLGLLCVFVTNGPFIDGRTTGIEP 32 >gb|KJB06854.1| hypothetical protein B456_001G165200 [Gossypium raimondii] Length = 70 Score = 65.1 bits (157), Expect = 2e-08 Identities = 35/63 (55%), Positives = 35/63 (55%) Frame = +2 Query: 107 MSLKASR*LAEKILSRFVLFFRNKWSIY*WENMGTEPARGGFTIQCFDPLGYIHPYPHKG 286 M LKASR LAEK G EPARGGFTI C DPLGYI PYPH G Sbjct: 1 MRLKASRLLAEKCFLGLSCVSVTNGPFIDGRTTGIEPARGGFTIHCLDPLGYIRPYPHTG 60 Query: 287 LSL 295 LSL Sbjct: 61 LSL 63