BLASTX nr result
ID: Forsythia22_contig00060234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00060234 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100917.1| PREDICTED: uncharacterized protein LOC105179... 60 6e-07 >ref|XP_011100917.1| PREDICTED: uncharacterized protein LOC105179028 [Sesamum indicum] Length = 188 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 2/72 (2%) Frame = -2 Query: 222 LSIFDGKSDYSI*KQKTIAILVQQRVAKALDD--PENYPDELKKKHIEIADMNEIAYSSI 49 L FDGKSD+SI +QK IL+QQ+V KA+D +N DE K ++ +E AYSSI Sbjct: 6 LQSFDGKSDFSIWQQKMKGILIQQKVFKAIDSKYTDNISDEKKIQN------DEFAYSSI 59 Query: 48 ILHLFDNIFRQV 13 IL+L DN+ R+V Sbjct: 60 ILNLSDNVLRKV 71