BLASTX nr result
ID: Forsythia22_contig00060223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00060223 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ72665.1| 60S ribosomal protein L26 [Aureobasidium namibiae... 83 6e-14 gb|KEQ66386.1| 60S ribosomal protein L26 [Aureobasidium melanoge... 83 6e-14 gb|KEQ95299.1| hypothetical protein AUEXF2481DRAFT_79743 [Aureob... 82 1e-13 gb|EYE91001.1| ribosomal protein L26 [Aspergillus ruber CBS 135680] 76 8e-12 ref|XP_007580513.1| putative 60s ribosomal protein l26 protein [... 75 1e-11 gb|KKY18993.1| putative 60s ribosomal protein l26 [Diplodia seri... 73 8e-11 ref|XP_007931151.1| hypothetical protein MYCFIDRAFT_212489 [Pseu... 73 8e-11 ref|XP_007776489.1| large subunit ribosomal protein L26e [Conios... 72 1e-10 gb|EKG19425.1| Ribosomal protein L26/L24P eukaryotic/archaeal [M... 72 1e-10 ref|XP_007713820.1| hypothetical protein COCCADRAFT_100136 [Bipo... 72 1e-10 gb|EME41012.1| hypothetical protein DOTSEDRAFT_74528 [Dothistrom... 72 1e-10 ref|XP_001823374.1| 60S ribosomal protein L26 [Aspergillus oryza... 72 1e-10 ref|XP_003836074.1| similar to 60S ribosomal protein L26 [Leptos... 72 1e-10 dbj|GAO88225.1| 60S ribosomal protein L26-1 [Neosartorya udagawae] 72 2e-10 gb|EPE03787.1| 60s ribosomal protein l26 [Ophiostoma piceae UAMH... 72 2e-10 gb|EMD91574.1| hypothetical protein COCHEDRAFT_1021505 [Bipolari... 72 2e-10 ref|XP_001930861.1| 60S ribosomal protein L26 [Pyrenophora triti... 72 2e-10 ref|XP_003011966.1| hypothetical protein ARB_01721 [Arthroderma ... 71 2e-10 gb|EGD95669.1| 60S ribosomal protein L26 [Trichophyton tonsurans... 71 2e-10 ref|XP_003176032.1| 60S ribosomal protein L26 [Microsporum gypse... 71 2e-10 >gb|KEQ72665.1| 60S ribosomal protein L26 [Aureobasidium namibiae CBS 147.97] gi|662521355|gb|KEQ78767.1| 60S ribosomal protein L26 [Aureobasidium pullulans EXF-150] Length = 136 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKWVIHV VAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL Sbjct: 76 LKWVIHVDRVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 119 >gb|KEQ66386.1| 60S ribosomal protein L26 [Aureobasidium melanogenum CBS 110374] Length = 136 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKWVIHV VAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL Sbjct: 76 LKWVIHVDRVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 119 >gb|KEQ95299.1| hypothetical protein AUEXF2481DRAFT_79743 [Aureobasidium subglaciale EXF-2481] Length = 136 Score = 82.0 bits (201), Expect = 1e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKWVIHV VAREKSNGQSVPLGI+PSKVVITSLKLDKDREEIL Sbjct: 76 LKWVIHVDRVAREKSNGQSVPLGISPSKVVITSLKLDKDREEIL 119 >gb|EYE91001.1| ribosomal protein L26 [Aspergillus ruber CBS 135680] Length = 132 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKWV+HV V REKSNGQSVPLGIAPSKVVIT L++DKDRE+IL Sbjct: 76 LKWVVHVERVVREKSNGQSVPLGIAPSKVVITKLRMDKDREQIL 119 >ref|XP_007580513.1| putative 60s ribosomal protein l26 protein [Neofusicoccum parvum UCRNP2] gi|485928265|gb|EOD52001.1| putative 60s ribosomal protein l26 protein [Neofusicoccum parvum UCRNP2] Length = 137 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIHV VAREKSNGQSVPLGIAPSKVV+T LKLDKDRE IL Sbjct: 77 LKYVIHVERVAREKSNGQSVPLGIAPSKVVVTKLKLDKDRENIL 120 >gb|KKY18993.1| putative 60s ribosomal protein l26 [Diplodia seriata] Length = 136 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIHV V+REKSNGQS PLGIAPSKVV+T LKLDKDRE IL Sbjct: 76 LKYVIHVERVSREKSNGQSTPLGIAPSKVVVTKLKLDKDRENIL 119 >ref|XP_007931151.1| hypothetical protein MYCFIDRAFT_212489 [Pseudocercospora fijiensis CIRAD86] gi|452979139|gb|EME78902.1| hypothetical protein MYCFIDRAFT_212489 [Pseudocercospora fijiensis CIRAD86] Length = 137 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIH+ VAREKSNGQSVPLGIAPSKV IT LKLDKDRE+I+ Sbjct: 76 LKYVIHIERVAREKSNGQSVPLGIAPSKVEITKLKLDKDREKII 119 >ref|XP_007776489.1| large subunit ribosomal protein L26e [Coniosporium apollinis CBS 100218] gi|494823853|gb|EON61172.1| large subunit ribosomal protein L26e [Coniosporium apollinis CBS 100218] Length = 108 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIHV V+REKSNGQSVP+GIAPSKVVIT LK+DKDRE I+ Sbjct: 46 LKYVIHVERVSREKSNGQSVPIGIAPSKVVITKLKMDKDRESII 89 >gb|EKG19425.1| Ribosomal protein L26/L24P eukaryotic/archaeal [Macrophomina phaseolina MS6] Length = 136 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIHV V REKSNGQS PLGIAPSKVV+T LKLDKDRE IL Sbjct: 76 LKYVIHVERVVREKSNGQSTPLGIAPSKVVVTKLKLDKDRENIL 119 >ref|XP_007713820.1| hypothetical protein COCCADRAFT_100136 [Bipolaris zeicola 26-R-13] gi|576917651|gb|EUC31867.1| hypothetical protein COCCADRAFT_100136 [Bipolaris zeicola 26-R-13] gi|578492423|gb|EUN29823.1| hypothetical protein COCVIDRAFT_35447 [Bipolaris victoriae FI3] Length = 135 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+ IHV G+ REKSNGQSVP+ IAPSKVVIT LKLDKDRE IL Sbjct: 76 LKYCIHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRESIL 119 >gb|EME41012.1| hypothetical protein DOTSEDRAFT_74528 [Dothistroma septosporum NZE10] Length = 135 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIHV VAREKSNGQSVP+GIAPSKV IT +KLDKDRE IL Sbjct: 76 LKYVIHVERVAREKSNGQSVPIGIAPSKVEITKIKLDKDRESIL 119 >ref|XP_001823374.1| 60S ribosomal protein L26 [Aspergillus oryzae RIB40] gi|238495046|ref|XP_002378759.1| 60S ribosomal protein L26 [Aspergillus flavus NRRL3357] gi|83772111|dbj|BAE62241.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220695409|gb|EED51752.1| ribosomal protein L26 [Aspergillus flavus NRRL3357] gi|391871500|gb|EIT80660.1| 60S ribosomal protein [Aspergillus oryzae 3.042] gi|635508764|gb|KDE80739.1| 60S ribosomal protein [Aspergillus oryzae 100-8] gi|768704005|gb|KJJ30907.1| hypothetical protein P034_03626905 [Aspergillus flavus AF70] gi|770305265|gb|KJK63150.1| hypothetical protein P875_00033965 [Aspergillus parasiticus SU-1] Length = 134 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKWV+HV V REKSNGQSVPLGI PSKVVI+ L LDKDRE+IL Sbjct: 76 LKWVVHVERVVREKSNGQSVPLGIHPSKVVISKLHLDKDREQIL 119 >ref|XP_003836074.1| similar to 60S ribosomal protein L26 [Leptosphaeria maculans JN3] gi|312212626|emb|CBX92709.1| similar to 60S ribosomal protein L26 [Leptosphaeria maculans JN3] Length = 136 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+ +HV G+ REKSNGQSVP+ IAPSKVVIT LKLDKDRE+IL Sbjct: 76 LKYCLHVAGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQIL 119 >dbj|GAO88225.1| 60S ribosomal protein L26-1 [Neosartorya udagawae] Length = 200 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LKW +HV VAREKSNGQSVP+ I PSKVVIT LKLDKDRE+IL Sbjct: 143 LKWCVHVERVAREKSNGQSVPIPIHPSKVVITKLKLDKDREQIL 186 >gb|EPE03787.1| 60s ribosomal protein l26 [Ophiostoma piceae UAMH 11346] Length = 137 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+VIH+ GV+R+K+NGQSVPLGI PS VVIT LKLDKDRE IL Sbjct: 76 LKYVIHIAGVSRDKANGQSVPLGIHPSNVVITKLKLDKDRESIL 119 >gb|EMD91574.1| hypothetical protein COCHEDRAFT_1021505 [Bipolaris maydis C5] gi|477591597|gb|ENI08669.1| hypothetical protein COCC4DRAFT_30433 [Bipolaris maydis ATCC 48331] Length = 135 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+ IHV G+ REKSNGQSVP+ IAPSKVVIT LKLDKDRE IL Sbjct: 76 LKYCIHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRETIL 119 >ref|XP_001930861.1| 60S ribosomal protein L26 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330932144|ref|XP_003303667.1| 60S ribosomal protein L26 [Pyrenophora teres f. teres 0-1] gi|187972467|gb|EDU39966.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311320196|gb|EFQ88250.1| hypothetical protein PTT_15978 [Pyrenophora teres f. teres 0-1] Length = 135 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+ IHV G+ REKSNGQSVP+ IAPSKVV+T LKLDKDRE IL Sbjct: 76 LKYCIHVNGIVREKSNGQSVPIPIAPSKVVVTKLKLDKDRESIL 119 >ref|XP_003011966.1| hypothetical protein ARB_01721 [Arthroderma benhamiae CBS 112371] gi|302661598|ref|XP_003022465.1| hypothetical protein TRV_03415 [Trichophyton verrucosum HKI 0517] gi|327309478|ref|XP_003239430.1| 60S ribosomal protein L26 [Trichophyton rubrum CBS 118892] gi|291175521|gb|EFE31326.1| hypothetical protein ARB_01721 [Arthroderma benhamiae CBS 112371] gi|291186411|gb|EFE41847.1| hypothetical protein TRV_03415 [Trichophyton verrucosum HKI 0517] gi|326459686|gb|EGD85139.1| ribosomal protein L24 [Trichophyton rubrum CBS 118892] gi|607864341|gb|EZF09842.1| ribosomal protein L24 [Trichophyton rubrum MR850] gi|607898881|gb|EZF36704.1| ribosomal protein L24 [Trichophyton rubrum CBS 100081] gi|607910975|gb|EZF47296.1| ribosomal protein L24 [Trichophyton rubrum CBS 288.86] gi|607923155|gb|EZF58034.1| ribosomal protein L24 [Trichophyton rubrum CBS 289.86] gi|607934963|gb|EZF68539.1| ribosomal protein L24 [Trichophyton soudanense CBS 452.61] gi|607946991|gb|EZF79252.1| ribosomal protein L24 [Trichophyton rubrum MR1448] gi|607959069|gb|EZF89851.1| ribosomal protein L24 [Trichophyton rubrum MR1459] gi|607971563|gb|EZG00936.1| ribosomal protein L24 [Trichophyton rubrum CBS 735.88] gi|607983073|gb|EZG11443.1| ribosomal protein L24 [Trichophyton rubrum CBS 202.88] gi|633053088|gb|KDB28473.1| ribosomal protein L24 [Trichophyton rubrum D6] gi|861299600|gb|KMQ43881.1| Ribosomal protein L2 domain 2 [Trichophyton rubrum] Length = 133 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+V+HV V+REKSNGQSVP+GI PSKVVIT LKLDKDRE IL Sbjct: 76 LKYVVHVERVSREKSNGQSVPIGIHPSKVVITKLKLDKDRESIL 119 >gb|EGD95669.1| 60S ribosomal protein L26 [Trichophyton tonsurans CBS 112818] gi|326485422|gb|EGE09432.1| 60S ribosomal protein L26 [Trichophyton equinum CBS 127.97] gi|607889630|gb|EZF29945.1| ribosomal protein L24 [Trichophyton interdigitale H6] gi|633044800|gb|KDB21730.1| ribosomal protein L24 [Trichophyton interdigitale MR816] Length = 133 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+V+HV V+REKSNGQSVP+GI PSKVVIT LKLDKDRE IL Sbjct: 76 LKYVVHVERVSREKSNGQSVPIGIHPSKVVITKLKLDKDRESIL 119 >ref|XP_003176032.1| 60S ribosomal protein L26 [Microsporum gypseum CBS 118893] gi|311337878|gb|EFQ97080.1| 60S ribosomal protein [Microsporum gypseum CBS 118893] Length = 133 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 255 LKWVIHVGGVAREKSNGQSVPLGIAPSKVVITSLKLDKDREEIL 124 LK+V+HV V+REKSNGQSVP+GI PSKVVIT LKLDKDRE IL Sbjct: 76 LKYVVHVERVSREKSNGQSVPIGIHPSKVVITKLKLDKDRESIL 119