BLASTX nr result
ID: Forsythia22_contig00060178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00060178 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224669.1| hypothetical protein PRUPE_ppa025989mg [Prun... 52 1e-06 >ref|XP_007224669.1| hypothetical protein PRUPE_ppa025989mg [Prunus persica] gi|462421605|gb|EMJ25868.1| hypothetical protein PRUPE_ppa025989mg [Prunus persica] Length = 460 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +2 Query: 62 CVRKVEDLMKPSQHIDKVMHAITREEVLKNRLRLK 166 CVR EDLMK SQHI+KV+H ++E++LKN+LRLK Sbjct: 80 CVRCAEDLMKSSQHIEKVIHKQSKEQILKNQLRLK 114 Score = 26.9 bits (58), Expect(2) = 1e-06 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 4 GDKCAFLTHMGSTPSSFHHMC 66 G CAFL H+G PSS H+ C Sbjct: 61 GKNCAFLLHVGG-PSSPHNKC 80