BLASTX nr result
ID: Forsythia22_contig00059959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059959 (405 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 57 4e-13 gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii] 47 5e-09 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 57.0 bits (136), Expect(2) = 4e-13 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 267 KKVYPCFDSVSQKLYVSCHFMFLEHTPLFSILHNSHNMIKSKLI 136 KK Y CFD ++QKLYVS H +FLEH P FSI +H++ KS LI Sbjct: 739 KKGYRCFDPITQKLYVSHHVVFLEHIPFFSIPSTTHSLTKSDLI 782 Score = 43.9 bits (102), Expect(2) = 4e-13 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = -3 Query: 400 LYKRPPDSSVLKIFCCTCIILCPEVKRSKLTSRSIVYVLLRYNKKK 263 LY PD S ++F CT +L P V+R+KL+SRS + V L Y + K Sbjct: 694 LYGHVPDYSSFRVFGCTYFVLHPHVERNKLSSRSAICVFLGYGEGK 739 >gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii] Length = 732 Score = 47.4 bits (111), Expect(2) = 5e-09 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -3 Query: 400 LYKRPPDSSVLKIFCCTCIILCPEVKRSKLTSRSIVYVLLRY 275 LY PD S LK+F TC +L P+V+RSKL+SRS + V L Y Sbjct: 210 LYASVPDYSSLKVFGSTCFVLRPQVERSKLSSRSAICVFLGY 251 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -1 Query: 267 KKVYPCFDSVSQKLYVSCHFMFLEHTPLFSILHNSHNMIKSKL 139 +K Y C+D ++KLYVS H +FLEH P +S S S+L Sbjct: 255 QKGYRCYDPHARKLYVSRHVVFLEHIPFYSFSSESSITNSSEL 297