BLASTX nr result
ID: Forsythia22_contig00059833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059833 (241 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858238.1| PREDICTED: zinc finger protein ZAT12-like [E... 60 4e-07 ref|XP_011077219.1| PREDICTED: zinc finger protein ZAT11-like [S... 58 2e-06 >ref|XP_012858238.1| PREDICTED: zinc finger protein ZAT12-like [Erythranthe guttatus] gi|604300055|gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Erythranthe guttata] Length = 183 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 168 IVKRSNSMRFFCLDLNLTPSENNFLLFGKVAPAVDCFF 55 IVK+SNS R C+DLNLTPSEN F LFG VAPAV+CFF Sbjct: 147 IVKKSNSRRVLCMDLNLTPSENKF-LFGNVAPAVNCFF 183 >ref|XP_011077219.1| PREDICTED: zinc finger protein ZAT11-like [Sesamum indicum] Length = 179 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 168 IVKRSNSMRFFCLDLNLTPSENNFLLFGKV-APAVDCFF 55 IVK+S S R CLDLNLTPSEN F LFGKV APAVDCFF Sbjct: 142 IVKKSKSTRVLCLDLNLTPSENKF-LFGKVAAPAVDCFF 179