BLASTX nr result
ID: Forsythia22_contig00059781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059781 (413 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386826.1| hypothetical protein POPTR_0002s22610g [Popu... 57 5e-06 ref|XP_009357245.1| PREDICTED: zinc finger BED domain-containing... 56 8e-06 >ref|XP_006386826.1| hypothetical protein POPTR_0002s22610g [Populus trichocarpa] gi|550345612|gb|ERP64623.1| hypothetical protein POPTR_0002s22610g [Populus trichocarpa] Length = 600 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 298 DLLGWWKANLRTYAILQNVARHVLAILVSTVTFESAFT 411 D+LGWWK+N Y L VA+HVLAIL+STV FESAF+ Sbjct: 496 DILGWWKSNALKYKTLSKVAQHVLAILISTVAFESAFS 533 >ref|XP_009357245.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like [Pyrus x bretschneideri] Length = 356 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 6/70 (8%) Frame = +1 Query: 220 TTSTNNAKIELICSWRSWHCLDRTI------FDLLGWWKANLRTYAILQNVARHVLAILV 381 T ST+N K +L H LD + FD+LGWWK+N Y IL +AR +LAILV Sbjct: 252 TVSTDNVKSKLD------HYLDEVVLPRTSDFDILGWWKSNGTKYPILSALARDILAILV 305 Query: 382 STVTFESAFT 411 STV ES F+ Sbjct: 306 STVASESTFS 315