BLASTX nr result
ID: Forsythia22_contig00059547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059547 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 120 5e-25 ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 94 3e-17 ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 91 2e-16 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 120 bits (300), Expect = 5e-25 Identities = 58/62 (93%), Positives = 58/62 (93%) Frame = -1 Query: 186 FWLTLSLEFPNPARSRLRVLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRI 7 F L LSLEF NPARSRLRVLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKV FLHRI Sbjct: 77 FCLLLSLEFKNPARSRLRVLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVSFLHRI 136 Query: 6 AP 1 AP Sbjct: 137 AP 138 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435128|ref|YP_004222346.1| hypothetical protein BevumaM_p112 [Beta vulgaris subsp. maritima] gi|346683219|ref|YP_004842151.1| hypothetical protein BemaM_p107 [Beta macrocarpa] gi|9087354|dbj|BAA99498.1| orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905682|emb|CBJ14076.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439861|emb|CBJ17566.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148051|emb|CBJ20714.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500137|emb|CBX24956.1| hypothetical protein [Beta macrocarpa] gi|384939116|emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 126 WTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAP 1 WTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAP Sbjct: 41 WTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAP 82 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] gi|56806642|dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/61 (70%), Positives = 48/61 (78%) Frame = -1 Query: 183 WLTLSLEFPNPARSRLRVLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIA 4 ++ S F + + S +WT R LRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIA Sbjct: 52 FIAYSFTFISKSGSLPATVWTFRLLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIA 111 Query: 3 P 1 P Sbjct: 112 P 112