BLASTX nr result
ID: Forsythia22_contig00059047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059047 (307 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077010.1| PREDICTED: U-box domain-containing protein 5... 69 2e-09 ref|XP_009793818.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009793817.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009793816.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009793815.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009610864.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009610856.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_009610849.1| PREDICTED: U-box domain-containing protein 5... 65 2e-08 ref|XP_012087297.1| PREDICTED: U-box domain-containing protein 3... 64 3e-08 gb|KDP25035.1| hypothetical protein JCGZ_22570 [Jatropha curcas] 64 3e-08 ref|XP_006340592.1| PREDICTED: U-box domain-containing protein 5... 62 1e-07 ref|XP_006374811.1| hypothetical protein POPTR_0014s01190g [Popu... 62 1e-07 ref|XP_007023631.1| Kinase protein with adenine nucleotide alpha... 62 1e-07 ref|XP_007023630.1| Kinase protein with adenine nucleotide alpha... 62 1e-07 gb|KHN31852.1| U-box domain-containing protein 35 [Glycine soja] 62 1e-07 gb|KHN22379.1| U-box domain-containing protein 35 [Glycine soja] 62 1e-07 ref|XP_006597079.1| PREDICTED: U-box domain-containing protein 3... 62 1e-07 ref|XP_006595204.1| PREDICTED: U-box domain-containing protein 3... 62 1e-07 ref|XP_009128323.1| PREDICTED: U-box domain-containing protein 5... 61 3e-07 ref|XP_002513301.1| ATP binding protein, putative [Ricinus commu... 61 3e-07 >ref|XP_011077010.1| PREDICTED: U-box domain-containing protein 52-like [Sesamum indicum] Length = 783 Score = 68.6 bits (166), Expect = 2e-09 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 3/48 (6%) Frame = -1 Query: 136 MHLPNPKGSNSV-KRG--NGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LPN KGS+S KRG NGLVAV+IDKDKGSQ+A+KW IENLLTRGQ Sbjct: 1 MWLPNAKGSSSPGKRGGRNGLVAVAIDKDKGSQYAIKWAIENLLTRGQ 48 >ref|XP_009793818.1| PREDICTED: U-box domain-containing protein 52-like isoform X4 [Nicotiana sylvestris] Length = 781 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009793817.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 [Nicotiana sylvestris] Length = 801 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009793816.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Nicotiana sylvestris] Length = 806 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009793815.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 [Nicotiana sylvestris] Length = 810 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009610864.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 [Nicotiana tomentosiformis] Length = 801 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009610856.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Nicotiana tomentosiformis] Length = 806 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_009610849.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 [Nicotiana tomentosiformis] Length = 810 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG--LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 EKM LPN KGS + +RGNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 EKMWLPNNKGSPANRRGNGTGVVAIAIDKDKGSQYAIKWATDNLVNRGQ 59 >ref|XP_012087297.1| PREDICTED: U-box domain-containing protein 35-like [Jatropha curcas] Length = 774 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 121 PKGSNSVKRGNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 PK + S K GNG+VAV+IDKDKGSQ+ALKW +ENLL+RGQ Sbjct: 4 PKSNGSKKGGNGIVAVAIDKDKGSQNALKWALENLLSRGQ 43 >gb|KDP25035.1| hypothetical protein JCGZ_22570 [Jatropha curcas] Length = 1031 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 121 PKGSNSVKRGNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 PK + S K GNG+VAV+IDKDKGSQ+ALKW +ENLL+RGQ Sbjct: 4 PKSNGSKKGGNGIVAVAIDKDKGSQNALKWALENLLSRGQ 43 >ref|XP_006340592.1| PREDICTED: U-box domain-containing protein 52-like [Solanum tuberosum] Length = 770 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 4/51 (7%) Frame = -1 Query: 142 EKMHLPNPKGSNSVKRGNG----LVAVSIDKDKGSQHALKWTIENLLTRGQ 2 +KM LPN KGS K+GNG +VA++IDKDKGSQ+A+KW +NL+ RGQ Sbjct: 11 DKMWLPNSKGSPGSKKGNGNGTGVVALAIDKDKGSQYAIKWATDNLVKRGQ 61 >ref|XP_006374811.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa] gi|550323088|gb|ERP52608.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa] Length = 705 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -1 Query: 136 MHLPNPKGSNSVKRGNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M L G+ GNGLVAV++DKDKGSQ+ALKWT+ENLLT+GQ Sbjct: 1 MWLSKGHGTKKGGEGNGLVAVAVDKDKGSQNALKWTVENLLTKGQ 45 >ref|XP_007023631.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 2 [Theobroma cacao] gi|508778997|gb|EOY26253.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 2 [Theobroma cacao] Length = 781 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 136 MHLPNPKGSNSVKR-GNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M PN S++ K GNGLVAV+IDKDKGSQHAL+W +ENLL+RGQ Sbjct: 1 MWTPNRYASSAKKGVGNGLVAVAIDKDKGSQHALRWAVENLLSRGQ 46 >ref|XP_007023630.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 1 [Theobroma cacao] gi|508778996|gb|EOY26252.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 1 [Theobroma cacao] Length = 779 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 136 MHLPNPKGSNSVKR-GNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M PN S++ K GNGLVAV+IDKDKGSQHAL+W +ENLL+RGQ Sbjct: 1 MWTPNRYASSAKKGVGNGLVAVAIDKDKGSQHALRWAVENLLSRGQ 46 >gb|KHN31852.1| U-box domain-containing protein 35 [Glycine soja] Length = 756 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 136 MHLPNPKGSNSVKRG--NGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LP+PK S K G NGLVAV+IDKDKGSQ+ALKW ++ LLTRGQ Sbjct: 1 MWLPSPKASGIRKGGGVNGLVAVAIDKDKGSQYALKWAVDCLLTRGQ 47 >gb|KHN22379.1| U-box domain-containing protein 35 [Glycine soja] Length = 831 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 136 MHLPNPKGSNSVKRG--NGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LPNPK S K G NGLVAV+IDK+KGSQ+ALKW ++ LLTRGQ Sbjct: 1 MWLPNPKASGIRKGGGGNGLVAVAIDKNKGSQYALKWAVDCLLTRGQ 47 >ref|XP_006597079.1| PREDICTED: U-box domain-containing protein 35-like [Glycine max] Length = 803 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 136 MHLPNPKGSNSVKRG--NGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LPNPK S K G NGLVAV+IDK+KGSQ+ALKW ++ LLTRGQ Sbjct: 1 MWLPNPKASGIRKGGGGNGLVAVAIDKNKGSQYALKWAVDCLLTRGQ 47 >ref|XP_006595204.1| PREDICTED: U-box domain-containing protein 35-like [Glycine max] Length = 782 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 136 MHLPNPKGSNSVKRG--NGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LP+PK S K G NGLVAV+IDKDKGSQ+ALKW ++ LLTRGQ Sbjct: 1 MWLPSPKASGIRKGGGVNGLVAVAIDKDKGSQYALKWAVDCLLTRGQ 47 >ref|XP_009128323.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Brassica rapa] gi|685274603|ref|XP_009128324.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Brassica rapa] Length = 760 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -1 Query: 136 MHLPNPKGSNSVKRGNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 M LP + G G VAV+IDKDKGSQHALKWTIENL +RGQ Sbjct: 1 MWLPKANNGGKKETGKGSVAVAIDKDKGSQHALKWTIENLASRGQ 45 >ref|XP_002513301.1| ATP binding protein, putative [Ricinus communis] gi|223547209|gb|EEF48704.1| ATP binding protein, putative [Ricinus communis] Length = 786 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 121 PKGSNSVKRGNGLVAVSIDKDKGSQHALKWTIENLLTRGQ 2 PK + S K G GLVAV+IDKDKGSQ+ALKW +ENLL++GQ Sbjct: 4 PKTNGSKKAGTGLVAVAIDKDKGSQNALKWALENLLSKGQ 43