BLASTX nr result
ID: Forsythia22_contig00058950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00058950 (434 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091330.1| PREDICTED: putative inactive disease suscept... 72 1e-10 ref|XP_012466152.1| PREDICTED: probable disease resistance prote... 60 7e-07 gb|KJB84201.1| hypothetical protein B456_N010100, partial [Gossy... 60 7e-07 gb|KJB45855.1| hypothetical protein B456_007G333300 [Gossypium r... 58 3e-06 ref|XP_011078623.1| PREDICTED: probable disease resistance RPP8-... 58 3e-06 ref|XP_012454087.1| PREDICTED: probable disease resistance prote... 57 4e-06 ref|XP_010658276.1| PREDICTED: probable disease resistance RPP8-... 57 4e-06 emb|CBI25483.3| unnamed protein product [Vitis vinifera] 57 4e-06 emb|CAN75123.1| hypothetical protein VITISV_040992 [Vitis vinifera] 57 4e-06 ref|XP_012434615.1| PREDICTED: probable disease resistance prote... 56 8e-06 >ref|XP_011091330.1| PREDICTED: putative inactive disease susceptibility protein LOV1 [Sesamum indicum] Length = 1004 Score = 72.0 bits (175), Expect = 1e-10 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYID---TIRGELENQ 263 G + + T++ELVIANMP FKRR+Q VQEE GED YKV+HIPSIT + + ELE Q Sbjct: 939 GIKHIATLKELVIANMPAAFKRRIQKVQEEEGEDIYKVKHIPSITLTEMSSSSMKELEKQ 998 Query: 262 LEG 254 L G Sbjct: 999 LSG 1001 >ref|XP_012466152.1| PREDICTED: probable disease resistance protein At1g58602, partial [Gossypium raimondii] Length = 958 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITY 296 G F+TT++EL I +MP++FK+R+ EEGGEDFYKV+H+PSI + Sbjct: 908 GLRFITTLKELKIESMPDEFKKRL----EEGGEDFYKVKHVPSIIF 949 >gb|KJB84201.1| hypothetical protein B456_N010100, partial [Gossypium raimondii] Length = 1030 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITY 296 G F+TT++EL I +MP++FK+R+ EEGGEDFYKV+H+PSI + Sbjct: 949 GLRFITTLKELKIESMPDEFKKRL----EEGGEDFYKVKHVPSIIF 990 >gb|KJB45855.1| hypothetical protein B456_007G333300 [Gossypium raimondii] Length = 939 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITY 296 G +F+TT++EL I +MP+ FK R++ EEGGEDFYKV+H+PSI + Sbjct: 897 GLKFITTLKELKIESMPKAFKDRLE---EEGGEDFYKVKHVPSIIF 939 >ref|XP_011078623.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Sesamum indicum] Length = 311 Score = 57.8 bits (138), Expect = 3e-06 Identities = 21/46 (45%), Positives = 38/46 (82%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITY 296 G +F+TT++EL+I +MPE+F++R ++V E GED++K++HIP + + Sbjct: 265 GLKFITTLKELLIVSMPEEFEKRARVVDGEEGEDYHKIKHIPHVDF 310 >ref|XP_012454087.1| PREDICTED: probable disease resistance protein RF9 [Gossypium raimondii] Length = 907 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYIDTIRG 278 G ++TT+++L++ MP +R++++ E+ GEDFYKV HIPSI D I G Sbjct: 843 GLRYITTLQKLILTAMPSSLTKRIEVIGEKEGEDFYKVRHIPSIQISDRIAG 894 >ref|XP_010658276.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Vitis vinifera] Length = 279 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = -2 Query: 427 EFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYID 290 +++TT++ L + MP+DF RR+Q++ + GEDFYKVEH+PSI ID Sbjct: 224 KYITTLQTLDVVFMPKDFIRRLQVINGKEGEDFYKVEHVPSIKLID 269 >emb|CBI25483.3| unnamed protein product [Vitis vinifera] Length = 836 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = -2 Query: 427 EFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYID 290 +++TT++ L + MP+DF RR+Q++ + GEDFYKVEH+PSI ID Sbjct: 781 KYITTLQTLDVVFMPKDFIRRLQVINGKEGEDFYKVEHVPSIKLID 826 >emb|CAN75123.1| hypothetical protein VITISV_040992 [Vitis vinifera] Length = 1191 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = -2 Query: 427 EFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYID 290 +++TT++ L + MP+DF RR+Q++ + GEDFYKVEH+PSI ID Sbjct: 879 KYITTLQTLDVVFMPKDFIRRLQVINGKEGEDFYKVEHVPSIKLID 924 >ref|XP_012434615.1| PREDICTED: probable disease resistance protein RF9 [Gossypium raimondii] gi|763778731|gb|KJB45854.1| hypothetical protein B456_007G333200 [Gossypium raimondii] Length = 961 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -2 Query: 433 GTEFVTTIRELVIANMPEDFKRRVQMVQEEGGEDFYKVEHIPSITYIDTIR 281 G F+TT++EL I +MP+ FK R+ EEGGEDFY+V+H+PSI + + +R Sbjct: 915 GLRFITTLKELKIESMPKAFKDRL----EEGGEDFYEVKHVPSIIFQNILR 961