BLASTX nr result
ID: Forsythia22_contig00058736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00058736 (311 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHN13810.1| reverse transcriptase [Aristotelia chilensis viru... 47 3e-07 >gb|AHN13810.1| reverse transcriptase [Aristotelia chilensis virus 1] Length = 758 Score = 47.0 bits (110), Expect(2) = 3e-07 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +3 Query: 150 PFSIICMMTPLSQDPLINGLPPELQDLIRNRTLQSRSKELMLKYQSIAIKQ 302 P II MM S PPE+Q+LI +T+Q+R+K+LM KYQSI I++ Sbjct: 428 PVPIITMMEDYST---FQFFPPEIQELIATKTIQTRAKDLMFKYQSICIRE 475 Score = 33.9 bits (76), Expect(2) = 3e-07 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 46 AEWFSNFEFDVKHIKGPTNLI 108 A WFS F+F VKHIKG N + Sbjct: 386 AXWFSRFDFQVKHIKGKNNTL 406