BLASTX nr result
ID: Forsythia22_contig00058397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00058397 (545 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992389.1| hypothetical protein Salmi_Mp122 (mitochondr... 59 1e-06 >ref|YP_008992389.1| hypothetical protein Salmi_Mp122 (mitochondrion) [Salvia miltiorrhiza] gi|534292358|gb|AGU16650.1| hypothetical protein Salmi_Mp122 (mitochondrion) [Salvia miltiorrhiza] Length = 117 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -3 Query: 153 W*AFCHGDQLHSLPWLLIWDFNSVLTVGERSNGTDISSYEVKDFADCC 10 W +LHS PWLL+ DFNS+L + E+ G ++S+YEV DF DCC Sbjct: 37 WNNLMETTELHSTPWLLVGDFNSLLRIDEKWFGAEVSAYEVNDFMDCC 84