BLASTX nr result
ID: Forsythia22_contig00058103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00058103 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837883.1| PREDICTED: uncharacterized protein LOC105958... 57 6e-06 >ref|XP_012837883.1| PREDICTED: uncharacterized protein LOC105958419 [Erythranthe guttatus] Length = 704 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/67 (44%), Positives = 42/67 (62%) Frame = -2 Query: 278 EAL*ELGDLFKGLCWKTMRLADIKRLKTTIPLSLCKLEQCSHLHSLI*WLHFSVHLLVDA 99 EAL ELGD FK LC KT+ +ADI +++ IP+ LCKLE+ +H +VHL +A Sbjct: 561 EALFELGDFFKTLCAKTLMIADIDKMERNIPVILCKLEKIFPPAFFDVMVHLAVHLPSEA 620 Query: 98 KSVGQMY 78 K G ++ Sbjct: 621 KLAGPVH 627