BLASTX nr result
ID: Forsythia22_contig00057565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00057565 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098016.1| hypothetical protein L484_004218 [Morus nota... 58 3e-06 >ref|XP_010098016.1| hypothetical protein L484_004218 [Morus notabilis] gi|587885528|gb|EXB74399.1| hypothetical protein L484_004218 [Morus notabilis] Length = 147 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/55 (41%), Positives = 37/55 (67%) Frame = +3 Query: 9 KSVSPNTKGVSEGGWRLNYQNWRLEMPVFEGMDPNGWIFRVDRYFAVNQTVEKER 173 +S + G EG W+ + RLEMPVF+G++P GW++RV+ YF +N+ E+E+ Sbjct: 77 ESTEGGSSGGREGIWKGECPSHRLEMPVFDGVNPEGWVYRVEHYFTLNRLTEEEK 131