BLASTX nr result
ID: Forsythia22_contig00055374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055374 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11414.1| unnamed protein product [Coffea canephora] 49 8e-07 >emb|CDP11414.1| unnamed protein product [Coffea canephora] Length = 947 Score = 48.5 bits (114), Expect(2) = 8e-07 Identities = 24/57 (42%), Positives = 37/57 (64%) Frame = +1 Query: 1 PQLALGPYQQTNLATVEELLHKRYMMNKQLKECLTQASTKMKHYANKKRCVRHFLLG 171 PQL+ GPY Q +A V + L +R+ ++ LK+ L QA +MK YA+++R R F +G Sbjct: 79 PQLSRGPYTQAKVAIVGDCLKERHKVDIILKQNLKQAQERMKKYADERRSERRFDIG 135 Score = 30.8 bits (68), Expect(2) = 8e-07 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 155 DISY*VYLKLHPYQQQRVVRREN*KLSPKY 244 DI V+L+L PY+Q V R N KLS +Y Sbjct: 133 DIGEWVHLRLQPYRQGSVAMRSNTKLSARY 162