BLASTX nr result
ID: Forsythia22_contig00055203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055203 (430 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080434.1| PREDICTED: uncharacterized protein LOC105163... 77 6e-12 >ref|XP_011080434.1| PREDICTED: uncharacterized protein LOC105163690 [Sesamum indicum] Length = 478 Score = 76.6 bits (187), Expect = 6e-12 Identities = 40/86 (46%), Positives = 53/86 (61%), Gaps = 4/86 (4%) Frame = -3 Query: 248 QLNXAVGGLCKTXXXXXXXXXXXXLYQSNQNLNCPANPRLFSPFLKRDPISRTNQTSED- 72 +++ G LC+T +Y SNQ NCPA+ FSPFLKR P+ ++ T E Sbjct: 6 KMDTVFGSLCRTLLIICLVFYFAFIYLSNQYPNCPASD-FFSPFLKRAPLLASDTTDETE 64 Query: 71 ---TPTNLSHLVFGILGSEEAWHQRK 3 +PTNLSHLVFG++GSE+AWH RK Sbjct: 65 TVGSPTNLSHLVFGLVGSEKAWHHRK 90