BLASTX nr result
ID: Forsythia22_contig00054365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00054365 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009790527.1| PREDICTED: uncharacterized protein LOC104237... 77 4e-12 ref|XP_009790526.1| PREDICTED: uncharacterized protein LOC104237... 77 4e-12 ref|XP_006387344.1| hypothetical protein POPTR_1212s00200g, part... 61 3e-07 ref|XP_011033121.1| PREDICTED: F-box protein At5g07610-like [Pop... 59 1e-06 ref|XP_011032923.1| PREDICTED: F-box protein At5g07610-like isof... 59 1e-06 ref|XP_011032922.1| PREDICTED: F-box protein At5g07610-like isof... 59 1e-06 ref|XP_006388529.1| hypothetical protein POPTR_0162s00200g [Popu... 59 2e-06 ref|XP_006388528.1| hypothetical protein POPTR_0162s00200g [Popu... 59 2e-06 >ref|XP_009790527.1| PREDICTED: uncharacterized protein LOC104237974 isoform X2 [Nicotiana sylvestris] Length = 442 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = +3 Query: 72 QEK*KMKVSNWSNLPDELKVDILCRMPDKNLIRLKCVCKSWYFLISNSCAPRFSSPSPSA 251 +E+ + + S+WS L D+LKV+ILCR+P+K LI K V K WYFLIS +C PR S PSPSA Sbjct: 12 KEQDEQESSDWSKLSDDLKVEILCRLPEKPLIAFKRVAKDWYFLISYACVPRLSPPSPSA 71 >ref|XP_009790526.1| PREDICTED: uncharacterized protein LOC104237974 isoform X1 [Nicotiana sylvestris] Length = 465 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = +3 Query: 72 QEK*KMKVSNWSNLPDELKVDILCRMPDKNLIRLKCVCKSWYFLISNSCAPRFSSPSPSA 251 +E+ + + S+WS L D+LKV+ILCR+P+K LI K V K WYFLIS +C PR S PSPSA Sbjct: 12 KEQDEQESSDWSKLSDDLKVEILCRLPEKPLIAFKRVAKDWYFLISYACVPRLSPPSPSA 71 >ref|XP_006387344.1| hypothetical protein POPTR_1212s00200g, partial [Populus trichocarpa] gi|550306661|gb|ERP46258.1| hypothetical protein POPTR_1212s00200g, partial [Populus trichocarpa] Length = 190 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/55 (54%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +3 Query: 105 SNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFLRL 266 S+LPD++ V+ILCR+ D K+LIRLK VCKSW LI+++C P+ S+ SP F+ L Sbjct: 23 SSLPDDVLVEILCRVTDRKHLIRLKSVCKSWNNLITDACVPKISASSPLHGFIYL 77 >ref|XP_011033121.1| PREDICTED: F-box protein At5g07610-like [Populus euphratica] Length = 421 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 102 WSNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFL 260 +S+LPD++ V+ILCR+ D K+LIRLK VCK W LI+++C P+ S SP F+ Sbjct: 36 FSSLPDDVLVEILCRVTDRKHLIRLKSVCKCWNNLITDACVPKISDSSPLRGFI 89 >ref|XP_011032923.1| PREDICTED: F-box protein At5g07610-like isoform X2 [Populus euphratica] Length = 419 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 102 WSNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFL 260 +S+LPD++ V+ILCR+ D K+LIRLK VCK W LI+++C P+ S SP F+ Sbjct: 36 FSSLPDDVLVEILCRVTDRKHLIRLKSVCKCWNNLITDACVPKISDSSPLRGFI 89 >ref|XP_011032922.1| PREDICTED: F-box protein At5g07610-like isoform X1 [Populus euphratica] Length = 425 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 102 WSNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFL 260 +S+LPD++ V+ILCR+ D K+LIRLK VCK W LI+++C P+ S SP F+ Sbjct: 42 FSSLPDDVLVEILCRVTDRKHLIRLKSVCKCWNNLITDACVPKISDSSPLRGFI 95 >ref|XP_006388529.1| hypothetical protein POPTR_0162s00200g [Populus trichocarpa] gi|550310339|gb|ERP47443.1| hypothetical protein POPTR_0162s00200g [Populus trichocarpa] Length = 423 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/53 (52%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 105 SNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFL 260 S+LPD++ V+ILCR+ D K+LIRLK VCK W LI+++C P+ S+ SP F+ Sbjct: 37 SSLPDDVLVEILCRVTDGKHLIRLKSVCKCWNNLITDACVPKISASSPLHGFI 89 >ref|XP_006388528.1| hypothetical protein POPTR_0162s00200g [Populus trichocarpa] gi|550310338|gb|ERP47442.1| hypothetical protein POPTR_0162s00200g [Populus trichocarpa] Length = 409 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/53 (52%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 105 SNLPDELKVDILCRMPD-KNLIRLKCVCKSWYFLISNSCAPRFSSPSPSAVFL 260 S+LPD++ V+ILCR+ D K+LIRLK VCK W LI+++C P+ S+ SP F+ Sbjct: 23 SSLPDDVLVEILCRVTDGKHLIRLKSVCKCWNNLITDACVPKISASSPLHGFI 75