BLASTX nr result
ID: Forsythia22_contig00054129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00054129 (311 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012859003.1| PREDICTED: uncharacterized protein LOC105978... 47 8e-06 >ref|XP_012859003.1| PREDICTED: uncharacterized protein LOC105978134 [Erythranthe guttatus] Length = 1175 Score = 47.4 bits (111), Expect(2) = 8e-06 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = -3 Query: 288 KQWSMAERLSDGNRNTKYFHAKTLNRCQKNHISKLRDKDGQ*K*RSNYWH 139 +Q S A+ + DG+RNTK+FHA+ +R ++N + K+RDK G WH Sbjct: 346 RQRSKAQWIKDGDRNTKFFHARATSRLKQNRVDKIRDKYGN-------WH 388 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = -1 Query: 167 NESEDQIIGILEEYFDDLYQSRRPTEAELRAGICGVNSALSQVDSDELDRL 15 + SE I +++EYFD ++ S RP++ ++ + N +VDS+ RL Sbjct: 388 HRSEAGIELVIQEYFDRIFSSSRPSDQDIDEIL---NDLEPRVDSEANQRL 435