BLASTX nr result
ID: Forsythia22_contig00054020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00054020 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13521.1| unnamed protein product [Coffea canephora] 57 6e-06 >emb|CDP13521.1| unnamed protein product [Coffea canephora] Length = 776 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 256 IINVTYHLHLMRNKGFCVEGSHRLLVNEYMANGS 357 II +HLHL+R KGFC EGSHRLLV EYMANGS Sbjct: 495 IIGSIHHLHLVRLKGFCAEGSHRLLVYEYMANGS 528