BLASTX nr result
ID: Forsythia22_contig00053580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00053580 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854315.1| PREDICTED: protein trichome birefringence-li... 60 8e-07 ref|XP_012854316.1| PREDICTED: protein trichome birefringence-li... 60 8e-07 ref|XP_011101018.1| PREDICTED: protein trichome birefringence-li... 58 3e-06 >ref|XP_012854315.1| PREDICTED: protein trichome birefringence-like 24 isoform X1 [Erythranthe guttatus] Length = 446 Score = 59.7 bits (143), Expect = 8e-07 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 214 VMKKMLYNLKSWWRSLRKFNNNVIQLGVSIFFLGFAFWAFSSQSTGF---FQVPSDKNTH 44 ++KKM YN KSWWR L K N VI+LGVS+ +G AF ++S+ F P +N H Sbjct: 1 MVKKMAYNWKSWWRPLHKNNYLVIKLGVSVLLVGLAFTLLFNRSSDFPPISDTPFLQNPH 60 Query: 43 ISPPHVDSLSYQQ 5 IS V+S+ QQ Sbjct: 61 ISESPVNSIVSQQ 73 >ref|XP_012854316.1| PREDICTED: protein trichome birefringence-like 24 isoform X2 [Erythranthe guttatus] gi|604304032|gb|EYU23382.1| hypothetical protein MIMGU_mgv1a006445mg [Erythranthe guttata] Length = 444 Score = 59.7 bits (143), Expect = 8e-07 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 214 VMKKMLYNLKSWWRSLRKFNNNVIQLGVSIFFLGFAFWAFSSQSTGF---FQVPSDKNTH 44 ++KKM YN KSWWR L K N VI+LGVS+ +G AF ++S+ F P +N H Sbjct: 1 MVKKMAYNWKSWWRPLHKNNYLVIKLGVSVLLVGLAFTLLFNRSSDFPPISDTPFLQNPH 60 Query: 43 ISPPHVDSLSYQQ 5 IS V+S+ QQ Sbjct: 61 ISESPVNSIVSQQ 73 >ref|XP_011101018.1| PREDICTED: protein trichome birefringence-like 23 [Sesamum indicum] Length = 441 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = -3 Query: 208 KKMLYNLKSWWRSLRKFNNNVIQLGVSIFFLGFAFWAFSSQSTGFFQVPSD---KNTHIS 38 +KM+Y+ KSWWR+L+K N VI+LGVS+ +G AF ++S+ VP +NT IS Sbjct: 3 RKMVYDWKSWWRALQKNNYFVIKLGVSVLLVGLAFRLLYNRSSDISPVPGAPFLENTRIS 62 Query: 37 PPHVDSLSYQQ 5 P V S+ Q+ Sbjct: 63 APTVVSVDSQE 73