BLASTX nr result
ID: Forsythia22_contig00053367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00053367 (200 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828691.1| PREDICTED: putative HVA22-like protein g [Er... 64 5e-08 ref|XP_011094253.1| PREDICTED: putative HVA22-like protein g [Se... 62 2e-07 >ref|XP_012828691.1| PREDICTED: putative HVA22-like protein g [Erythranthe guttatus] Length = 262 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = -2 Query: 190 TPKSESIQVQLHNHTQTVRAEDILIPDSDIGS---EKSGVDKHLHSPRIKFRRF 38 TPKSESI+V+L N T +R ED+LIPDS+IGS EKS D +H+ R++ RRF Sbjct: 203 TPKSESIKVELQNQTHFIRPEDVLIPDSNIGSKLREKSDADHDVHAARVRLRRF 256 >ref|XP_011094253.1| PREDICTED: putative HVA22-like protein g [Sesamum indicum] Length = 257 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = -2 Query: 196 AQTPKSESIQVQLHNHTQTVRAEDILIPDSDI---GSEKSGVDKHLHSPRIKFRRFKGSN 26 +QT KSE+I+V+L + TQ +R EDIL+P SDI EKSG D+ LH+ R++ RRF N Sbjct: 198 SQTAKSEAIKVELDSKTQFIRPEDILVPGSDICGGSEEKSGADRELHAARLRLRRFIDGN 257