BLASTX nr result
ID: Forsythia22_contig00053179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00053179 (399 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082095.1| PREDICTED: U-box domain-containing protein 3... 63 9e-08 >ref|XP_011082095.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 [Sesamum indicum] Length = 780 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -2 Query: 122 LWAIQPNM--MMPPMPRLVAVAIDRDKGSQIALKWTVDNLLG 3 +W QPN MPPM RLVAVAID+DKGSQ+ALKW V+NLLG Sbjct: 1 MWPPQPNSGERMPPMTRLVAVAIDKDKGSQVALKWAVENLLG 42