BLASTX nr result
ID: Forsythia22_contig00053116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00053116 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077162.1| PREDICTED: riboflavin biosynthesis protein P... 62 1e-07 ref|XP_012834614.1| PREDICTED: riboflavin biosynthesis protein P... 57 4e-06 >ref|XP_011077162.1| PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic [Sesamum indicum] Length = 607 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/54 (61%), Positives = 37/54 (68%) Frame = -3 Query: 163 MAFALGALTFSSPVTCKATSIVXXXXXSHALDATFIKRAAELADSSAGFTAPHP 2 MAF+LG L F S + C+AT ALDA +IKRAAELAD SAGFTAPHP Sbjct: 1 MAFSLGPLKFPSSLVCRATPTTSSSSSL-ALDAAYIKRAAELADKSAGFTAPHP 53 >ref|XP_012834614.1| PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic [Erythranthe guttatus] gi|604335571|gb|EYU39459.1| hypothetical protein MIMGU_mgv1a003063mg [Erythranthe guttata] Length = 611 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -3 Query: 166 LMAFALGALTFSSPVTCKA--TSIVXXXXXSHALDATFIKRAAELADSSAGFTAPHP 2 +MAF+L L F S C+A TS S +LDA +IKRAAELAD S+GFTAPHP Sbjct: 1 MMAFSLAGLNFPSSPVCRASFTSCSSSSPSSLSLDAAYIKRAAELADRSSGFTAPHP 57