BLASTX nr result
ID: Forsythia22_contig00051459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00051459 (462 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838... 57 6e-06 >ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa] Length = 1257 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/55 (40%), Positives = 37/55 (67%) Frame = -1 Query: 456 SVLTYIMNIFRLPKSICRDMRSIIIRFWWSYLNKNNG*KKIAWMRWSRLYRPRPG 292 S+ TY M+ F LP S+C+ ++S++ RFWW N+ KK+ W+ WS++ +P+ G Sbjct: 710 SIPTYPMSCFELPASLCKRIQSVLTRFWWDDPQSNS--KKMCWIAWSKMTKPKAG 762