BLASTX nr result
ID: Forsythia22_contig00051343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00051343 (479 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 64 5e-08 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 161 KIESEIKKFQTFYYISVATSIWVFLLELYEMKVSYTVLRGGFS 33 K+ +IKKFQTFY ISV+ + WVFL ELYEMK SYTVL GG S Sbjct: 6 KLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGGSS 48