BLASTX nr result
ID: Forsythia22_contig00051045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00051045 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18883.1| unnamed protein product [Coffea canephora] 64 5e-08 ref|XP_009596243.1| PREDICTED: transcription factor TCP8-like [N... 57 4e-06 >emb|CDP18883.1| unnamed protein product [Coffea canephora] Length = 408 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 232 IDLGMNLEKHHHQSEPQGSESGDENPKDSQ 143 +DLGMNLE+HHHQS+PQGS+SGDENPKDSQ Sbjct: 379 VDLGMNLEQHHHQSQPQGSDSGDENPKDSQ 408 >ref|XP_009596243.1| PREDICTED: transcription factor TCP8-like [Nicotiana tomentosiformis] Length = 326 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 232 IDLGMNLEKHHHQSEPQGSESGDENPKDSQ 143 IDLGMNLE+HHHQ++ QGSESGDEN KDSQ Sbjct: 296 IDLGMNLEQHHHQNQQQGSESGDENHKDSQ 325