BLASTX nr result
ID: Forsythia22_contig00051035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00051035 (247 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010677128.1| PREDICTED: bax inhibitor 1-like [Beta vulgar... 61 3e-07 ref|XP_012829123.1| PREDICTED: bax inhibitor 1-like [Erythranthe... 59 1e-06 ref|XP_011070265.1| PREDICTED: bax inhibitor 1-like [Sesamum ind... 59 1e-06 ref|XP_010494935.1| PREDICTED: bax inhibitor 1 [Camelina sativa] 59 1e-06 ref|XP_010481363.1| PREDICTED: bax inhibitor 1-like [Camelina sa... 59 1e-06 ref|XP_010449594.1| PREDICTED: bax inhibitor 1-like [Camelina sa... 59 1e-06 ref|XP_010441497.1| PREDICTED: bax inhibitor 1-like [Camelina sa... 59 1e-06 ref|XP_010439982.1| PREDICTED: bax inhibitor 1-like [Camelina sa... 59 1e-06 ref|XP_010434644.1| PREDICTED: bax inhibitor 1-like [Camelina sa... 59 1e-06 gb|KFK31395.1| hypothetical protein AALP_AA6G106500 [Arabis alpina] 59 1e-06 ref|XP_006398407.1| hypothetical protein EUTSA_v10001130mg [Eutr... 59 1e-06 ref|NP_199523.1| BAX inhibitor 1 [Arabidopsis thaliana] gi|12229... 59 1e-06 ref|XP_002868049.1| hypothetical protein ARALYDRAFT_914951 [Arab... 59 1e-06 ref|XP_002865140.1| ATBI-1 [Arabidopsis lyrata subsp. lyrata] gi... 59 1e-06 gb|AAM65074.1| Bax inhibitor-1 like [Arabidopsis thaliana] 59 1e-06 ref|XP_009128942.1| PREDICTED: bax inhibitor 1 [Brassica rapa] 59 2e-06 emb|CDY25984.1| BnaC09g20030D [Brassica napus] 59 2e-06 emb|CDY28973.1| BnaA02g25030D [Brassica napus] 59 2e-06 ref|XP_009114296.1| PREDICTED: bax inhibitor 1-like [Brassica ra... 59 2e-06 gb|ABD64918.1| bax inhibitor-like protein [Brassica oleracea] 59 2e-06 >ref|XP_010677128.1| PREDICTED: bax inhibitor 1-like [Beta vulgaris subsp. vulgaris] gi|870860479|gb|KMT11815.1| hypothetical protein BVRB_5g105150 [Beta vulgaris subsp. vulgaris] Length = 245 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA FGDLDY H +TLF+DFV VFV+ILIIM+++S++K Sbjct: 196 IIEKAHFGDLDYVKHAMTLFTDFVAVFVRILIIMLKNSMEK 236 >ref|XP_012829123.1| PREDICTED: bax inhibitor 1-like [Erythranthe guttatus] gi|604297700|gb|EYU17873.1| hypothetical protein MIMGU_mgv1a012518mg [Erythranthe guttata] Length = 248 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY NH LTLF+DFV VFV++LIIM++++ DK Sbjct: 199 IIEKAHLGDVDYVNHALTLFTDFVGVFVRVLIIMLKNASDK 239 >ref|XP_011070265.1| PREDICTED: bax inhibitor 1-like [Sesamum indicum] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA FGDLDY H LTLF+DFV VFV+ILIIM++++ +K Sbjct: 199 IIEKAHFGDLDYVKHALTLFTDFVAVFVRILIIMLKNASEK 239 >ref|XP_010494935.1| PREDICTED: bax inhibitor 1 [Camelina sativa] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 199 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 239 >ref|XP_010481363.1| PREDICTED: bax inhibitor 1-like [Camelina sativa] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 199 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 239 >ref|XP_010449594.1| PREDICTED: bax inhibitor 1-like [Camelina sativa] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_010441497.1| PREDICTED: bax inhibitor 1-like [Camelina sativa] Length = 250 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 201 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 241 >ref|XP_010439982.1| PREDICTED: bax inhibitor 1-like [Camelina sativa] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_010434644.1| PREDICTED: bax inhibitor 1-like [Camelina sativa] Length = 248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >gb|KFK31395.1| hypothetical protein AALP_AA6G106500 [Arabis alpina] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_006398407.1| hypothetical protein EUTSA_v10001130mg [Eutrema salsugineum] gi|557099496|gb|ESQ39860.1| hypothetical protein EUTSA_v10001130mg [Eutrema salsugineum] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHALTLFTDFVAVFVRILIIMLKNSADK 238 >ref|NP_199523.1| BAX inhibitor 1 [Arabidopsis thaliana] gi|12229684|sp|Q9LD45.1|BI1_ARATH RecName: Full=Bax inhibitor 1; Short=AtBI-1; Short=BI-1 gi|7209774|dbj|BAA89541.2| Bax inhibitor-1 [Arabidopsis thaliana] gi|8978079|dbj|BAA98107.1| Bax inhibitor-1 like [Arabidopsis thaliana] gi|11493975|gb|AAG35727.1| Bax inhibitor 1 [Arabidopsis thaliana] gi|20268760|gb|AAM14083.1| putative Bax inhibitor-1 [Arabidopsis thaliana] gi|21280947|gb|AAM45107.1| putative Bax inhibitor-1 [Arabidopsis thaliana] gi|332008090|gb|AED95473.1| BAX inhibitor 1 [Arabidopsis thaliana] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_002868049.1| hypothetical protein ARALYDRAFT_914951 [Arabidopsis lyrata subsp. lyrata] gi|297313885|gb|EFH44308.1| hypothetical protein ARALYDRAFT_914951 [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_002865140.1| ATBI-1 [Arabidopsis lyrata subsp. lyrata] gi|297310975|gb|EFH41399.1| ATBI-1 [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >gb|AAM65074.1| Bax inhibitor-1 like [Arabidopsis thaliana] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV+ILIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADK 238 >ref|XP_009128942.1| PREDICTED: bax inhibitor 1 [Brassica rapa] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV++LIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRVLIIMLKNSADK 238 >emb|CDY25984.1| BnaC09g20030D [Brassica napus] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV++LIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHALTLFTDFVAVFVRVLIIMLKNSADK 238 >emb|CDY28973.1| BnaA02g25030D [Brassica napus] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV++LIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHSLTLFTDFVAVFVRVLIIMLKNSADK 238 >ref|XP_009114296.1| PREDICTED: bax inhibitor 1-like [Brassica rapa] gi|674889245|emb|CDY43441.1| BnaAnng07130D [Brassica napus] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV++LIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHALTLFTDFVAVFVRVLIIMLKNSADK 238 >gb|ABD64918.1| bax inhibitor-like protein [Brassica oleracea] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 245 VIEKARFGDLDYTNHFLTLFSDFVDVFVQILIIMVESSLDK 123 +IEKA GD+DY H LTLF+DFV VFV++LIIM+++S DK Sbjct: 198 IIEKAHLGDMDYVKHALTLFTDFVAVFVRVLIIMLKNSADK 238