BLASTX nr result
ID: Forsythia22_contig00050988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050988 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79190.1| hypothetical protein VITISV_000232 [Vitis vinifera] 48 2e-06 emb|CAN68165.1| hypothetical protein VITISV_008538 [Vitis vinifera] 48 2e-06 >emb|CAN79190.1| hypothetical protein VITISV_000232 [Vitis vinifera] Length = 1935 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -1 Query: 323 GLSSNKKGVVTWRALLSAIVWIIWMGRNCRIFEQK 219 G S+K+G+V W+A AI+W++W RN RIFE K Sbjct: 1854 GFGSSKRGIVLWQAACIAILWVVWRERNARIFEDK 1888 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 222 KGAHSFELWEKATHLPSLWASTSEEFKGV 136 K +S LW+ L SLW S S+ FKG+ Sbjct: 1888 KSRNSENLWDMIHFLASLWVSCSKVFKGI 1916 >emb|CAN68165.1| hypothetical protein VITISV_008538 [Vitis vinifera] Length = 1765 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = -1 Query: 323 GLSSNKKGVVTWRALLSAIVWIIWMGRNCRIFEQK 219 G S+K+G+V W+A AI+W++W RN RIFE K Sbjct: 1254 GFGSSKRGIVLWQAACIAILWVVWRERNARIFEDK 1288 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 222 KGAHSFELWEKATHLPSLWASTSEEFKGV 136 K +S LW+ L SLW S S+ FKG+ Sbjct: 1288 KSRNSENLWDMIHFLASLWVSCSKVFKGI 1316