BLASTX nr result
ID: Forsythia22_contig00050788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050788 (317 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 116 3e-34 ref|XP_002439577.1| hypothetical protein SORBIDRAFT_09g014016 [S... 72 1e-10 ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncat... 70 4e-10 gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] 70 5e-10 emb|CBI23503.3| unnamed protein product [Vitis vinifera] 52 6e-08 ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp.... 59 1e-07 ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [S... 59 1e-06 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 116 bits (290), Expect(2) = 3e-34 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = +2 Query: 2 RVGRPKHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSQAFSSTSPLQSSIKLAFPRRYEM 181 RVGRP HHTTRIDANPPRYRTCDSHRIRLAQRLLNPS+AFSST PLQSSIKLAF RR EM Sbjct: 14 RVGRPNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRRSEM 73 Query: 182 G 184 G Sbjct: 74 G 74 Score = 55.8 bits (133), Expect(2) = 3e-34 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 183 GVFPSPIVCIGLASSRTKEAFWRTRACRKADDYIS 287 GVFPSPIVCIGLASSR+K + R RACRKAD YIS Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >ref|XP_002439577.1| hypothetical protein SORBIDRAFT_09g014016 [Sorghum bicolor] gi|241944862|gb|EES18007.1| hypothetical protein SORBIDRAFT_09g014016, partial [Sorghum bicolor] Length = 100 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 109 WI*ESLCEPYAVRIARTVTRGVRVYTCSVVLGPTHP 2 WI ESLCEPYAVR+ARTV RGVRVYTCSVV+GPTHP Sbjct: 6 WIFESLCEPYAVRVARTVRRGVRVYTCSVVVGPTHP 41 >ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncatula] Length = 1094 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 100 ESLCEPYAVRIARTVTRGVRVYTCSVVLGPTHP 2 ESLCEPYAVR+ARTVTRGVRVYTCSVV+GPTHP Sbjct: 91 ESLCEPYAVRVARTVTRGVRVYTCSVVVGPTHP 123 >gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] Length = 190 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 256 RVRQNASLVRDEAKPIHTIGEGKTPHFIAPGERKFD 149 R RQNASLVRDEAKP +TIGEGKTPHFIAPGERKFD Sbjct: 80 RRRQNASLVRDEAKPKYTIGEGKTPHFIAPGERKFD 115 >emb|CBI23503.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 52.4 bits (124), Expect(2) = 6e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 224 RSQADTYDRRRKDPPFHSAWGTQV 153 RSQADTYDRRRKDPPFHS WGT V Sbjct: 8 RSQADTYDRRRKDPPFHSTWGTGV 31 Score = 30.8 bits (68), Expect(2) = 6e-08 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 49 GVRVYTCSVVLGPTHP 2 GVRVYT SV +GPTHP Sbjct: 30 GVRVYTYSVRVGPTHP 45 >ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314288|gb|EFH44711.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 96 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 5/52 (9%) Frame = -1 Query: 293 LLAYVVVGLPTRTRPPECLLGSGRSQA----DTYDRRRKDPP-FHSAWGTQV 153 LLAYV+VGLPTRTRPPECLL +A YDRRRKDP F+SAW + + Sbjct: 14 LLAYVMVGLPTRTRPPECLLFVVLDEAKPIHTIYDRRRKDPHLFNSAWASLI 65 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 159 ASLIEDWRG 133 ASLIEDWRG Sbjct: 62 ASLIEDWRG 70 >ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [Sorghum bicolor] gi|241937305|gb|EES10450.1| hypothetical protein SORBIDRAFT_06g002025, partial [Sorghum bicolor] Length = 132 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +2 Query: 2 RVGRPKHHTTRIDANPPRYRTCDSHRIRLAQR 97 RV RP HHTT IDANPP YRTCDSHRIRL R Sbjct: 17 RVSRPNHHTTCIDANPPPYRTCDSHRIRLTVR 48